Property Summary

NCBI Gene PubMed Count 24
PubMed Score 79.33
PubTator Score 34.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.600 2.5e-07
psoriasis -1.700 9.9e-05
medulloblastoma, large-cell -1.500 6.1e-05
lung adenocarcinoma -1.200 4.8e-20
lung carcinoma -1.300 5.2e-12

Protein-protein Interaction (10)

Gene RIF (13)

PMID Text
26109066 demonstrate the essential role of domain cooperation within NDST-1 in producing HS with specific domain structures
25156775 Upregulation of NDST1 is associated with chemoresistance in breast cancer.
25125150 Our data confirm NDST1 mutations as a cause of autosomal recessive intellectual disability with a distinctive phenotype, and support an important function of NDST1 in human development.
23884416 These findings establish NDST1 as a target of miR-24 and demonstrate how such NDST1 suppression in endothelial cells results in reduced responsiveness to VEGFA
22632162 FITC-labeled Tat 47-59 peptide downregulates gene expression of N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1 (NDST1) in U-937 macrophages
21947487 MicroRNA-191 targets N-deacetylase/N-sulfotransferase 1 and promotes cell growth in human gastric carcinoma cell line MGC803
20198315 Observational study of gene-disease association. (HuGE Navigator)
20129923 Inhibitory peptides of the sulfotransferase domain of the heparan sulfate enzyme, N-deacetylase-N-sulfotransferase-1.
19915053 the expression of the NDST-1 isoform was approximately equal at all stages of mast cell maturation
19851296 Observational study of gene-disease association. (HuGE Navigator)
19710461 effect of targeted inactivation of the Ndst1 gene on the inflammatory response associated with allergic inflammation
19336475 Observational study of gene-disease association. (HuGE Navigator)
14966466 Altered expression of NDST-1 mRNA in glomerular basement membrane in puromycin aminonucleoside nephrosis.

AA Sequence

MPALACLRRLCRHVSPQAVLFLLFIFCLFSVFISAYYLYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPL      1 - 70
KPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALIIYEN     71 - 140
ILKYVNLDAWNRELLDKYCVAYGVGIIGFFKANENSLLSAQLKGFPLFLHSNLGLKDCSINPKSPLLYVT    141 - 210
RPSEVEKGVLPGEDWTVFQSNHSTYEPVLLAKTRSSESIPHLGADAGLHAALHATVVQDLGLHDGIQRVL    211 - 280
FGNNLNFWLHKLVFVDAVAFLTGKRLSLPLDRYILVDIDDIFVGKEGTRMKVEDVKALFDTQNELRAHIP    281 - 350
NFTFNLGYSGKFFHTGTNAEDAGDDLLLSYVKEFWWFPHMWSHMQPHLFHNQSVLAEQMALNKKFAVEHG    351 - 420
IPTDMGYAVAPHHSGVYPVHVQLYEAWKQVWSIRVTSTEEYPHLKPARYRRGFIHNGIMVLPRQTCGLFT    421 - 490
HTIFYNEYPGGSSELDKIINGGELFLTVLLNPISIFMTHLSNYGNDRLGLYTFKHLVRFLHSWTNLRLQT    491 - 560
LPPVQLAQKYFQIFSEEKDPLWQDPCEDKRHKDIWSKEKTCDRFPKLLIIGPQKTGTTALYLFLGMHPDL    561 - 630
SSNYPSSETFEEIQFFNGHNYHKGIDWYMEFFPIPSNTTSDFYFEKSANYFDSEVAPRRAAALLPKAKVL    631 - 700
TILINPADRAYSWYQHQRAHDDPVALKYTFHEVITAGSDASSKLRALQNRCLVPGWYATHIERWLSAYHA    701 - 770
NQILVLDGKLLRTEPAKVMDMVQKFLGVTNTIDYHKTLAFDPKKGFWCQLLEGGKTKCLGKSKGRKYPEM    771 - 840
DLDSRAFLKDYYRDHNIELSKLLYKMGQTLPTWLREDLQNTR                                841 - 882
//

Text Mined References (25)

PMID Year Title
26109066 2015 Role of Deacetylase Activity of N-Deacetylase/N-Sulfotransferase 1 in Forming N-Sulfated Domain in Heparan Sulfate.
25156775 2014 Methylation-regulated miR-149 modulates chemoresistance by targeting GlcNAc N-deacetylase/N-sulfotransferase-1 in human breast cancer.
25125150 2014 NDST1 missense mutations in autosomal recessive intellectual disability.
23884416 2013 MicroRNA-24 suppression of N-deacetylase/N-sulfotransferase-1 (NDST1) reduces endothelial cell responsiveness to vascular endothelial growth factor A (VEGFA).
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
21947487 2011 MicroRNA-191 targets N-deacetylase/N-sulfotransferase 1 and promotes cell growth in human gastric carcinoma cell line MGC803.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20129923 2011 Inhibitory peptides of the sulfotransferase domain of the heparan sulfate enzyme, N-deacetylase-N-sulfotransferase-1.
19915053 2009 Mast cell differentiation and activation is closely linked to expression of genes coding for the serglycin proteoglycan core protein and a distinct set of chondroitin sulfate and heparin sulfotransferases.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19710461 2009 Deficiency of endothelial heparan sulfates attenuates allergic airway inflammation.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
18337501 2008 Heparan sulfate biosynthesis enzymes EXT1 and EXT2 affect NDST1 expression and heparan sulfate sulfation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14966466 2004 Altered expression of NDST-1 messenger RNA in puromycin aminonucleoside nephrosis.
12634318 2003 Antibody-based assay for N-deacetylase activity of heparan sulfate/heparin N-deacetylase/N-sulfotransferase (NDST): novel characteristics of NDST-1 and -2.
12590599 2003 Distinct effects on heparan sulfate structure by different active site mutations in NDST-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11792394 2002 Immunopurification of Golgi vesicles by magnetic sorting.
10758005 2000 Overexpression of different isoforms of glucosaminyl N-deacetylase/N-sulfotransferase results in distinct heparan sulfate N-sulfation patterns.
10196134 1999 Crystal structure of the sulfotransferase domain of human heparan sulfate N-deacetylase/ N-sulfotransferase 1.
9915799 1999 Molecular cloning and expression of a third member of the heparan sulfate/heparin GlcNAc N-deacetylase/ N-sulfotransferase family.
9744796 1998 A role of Lys614 in the sulfotransferase activity of human heparan sulfate N-deacetylase/N-sulfotransferase.
9230113 1997 Localization of human heparan glucosaminyl N-deacetylase/N-sulphotransferase to the trans-Golgi network.
7601448 1995 Cloning of the human heparan sulfate-N-deacetylase/N-sulfotransferase gene from the Treacher Collins syndrome candidate region at 5q32-q33.1.