Property Summary

NCBI Gene PubMed Count 39
PubMed Score 37.81
PubTator Score 22.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma -2.134 3.0e-02
adult high grade glioma -2.300 2.7e-06
astrocytic glioma -1.300 2.2e-02
Astrocytoma, Pilocytic -1.300 3.8e-08
Atopic dermatitis 1.100 3.5e-03
atypical teratoid / rhabdoid tumor -2.300 2.7e-03
ependymoma -1.700 1.3e-07
esophageal adenocarcinoma -1.300 1.8e-02
glioblastoma -1.800 1.1e-06
group 3 medulloblastoma -3.100 2.3e-06
interstitial cystitis -1.300 8.1e-03
lung adenocarcinoma -1.300 3.6e-16
malignant mesothelioma 1.600 4.8e-07
medulloblastoma, large-cell -3.400 1.1e-05
oligodendroglioma -1.200 3.9e-09
Pick disease -2.100 1.2e-04
psoriasis 1.100 4.2e-08

Gene RIF (19)

AA Sequence

MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDA      1 - 70
PGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNID     71 - 140
PNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRD    141 - 210
LDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFK    211 - 280
YFLQGMGYIAYLKDRRLSGGAVPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTMEV    281 - 350
SC                                                                        351 - 352
//

Text Mined References (40)

PMID Year Title