Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.43
PubTator Score 8.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
posterior fossa group B ependymoma -1.800 2.6e-14
glioblastoma -2.100 8.0e-06
osteosarcoma 1.716 1.6e-05
sonic hedgehog group medulloblastoma -1.500 2.3e-06
atypical teratoid / rhabdoid tumor -1.900 4.2e-07
medulloblastoma, large-cell -1.400 3.8e-05
primitive neuroectodermal tumor -1.700 4.7e-06
primary pancreatic ductal adenocarcinoma 1.102 6.9e-03
tuberculosis 1.900 2.8e-09
lung cancer 1.900 1.6e-03
adult high grade glioma -2.000 6.8e-03
pilocytic astrocytoma -1.100 7.2e-07
aldosterone-producing adenoma -1.167 1.7e-02
acute myeloid leukemia -1.100 4.4e-02
subependymal giant cell astrocytoma -2.627 8.8e-03
lung carcinoma 1.200 3.0e-23
Pick disease -1.200 1.8e-03
ovarian cancer 1.200 6.1e-03
pituitary cancer 1.400 1.5e-04

Gene RIF (7)

PMID Text
25936780 We identified a lactate-dependent signaling pathway in hypoxia, mediated by the oxygen- and lactate-regulated protein NDRG family member 3 (NDRG3).
24222185 the aberrant expression of NDRG2 and NDRG3 may contribute to the malignant progression of prostate cancer
23725756 summarizes the current research on NDRG3 and NDRG4,including the molecular structure, cellular and tissue distribution, biological function,and function in cancer.
21725618 miR-122 plays an important role in HBV-related hepatocarcinogenesis by targeting NDRG3.
19460752 Knockdown of NDRG family member 3 (NDRG3) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18975380 NDRG3 is a tumor promoter, the overexpression of which may contribute to the malignant phenotype of tumors
11936845 Cloning and expression of the gene; highly expressed in brain and testis

AA Sequence

MDELQDVQLTEIKPLLNDKNGTRNFQDFDCQEHDIETTHGVVHVTIRGLPKGNRPVILTYHDIGLNHKSC      1 - 70
FNAFFNFEDMQEITQHFAVCHVDAPGQQEGAPSFPTGYQYPTMDELAEMLPPVLTHLSLKSIIGIGVGAG     71 - 140
AYILSRFALNHPELVEGLVLINVDPCAKGWIDWAASKLSGLTTNVVDIILAHHFGQEELQANLDLIQTYR    141 - 210
MHIAQDINQDNLQLFLNSYNGRRDLEIERPILGQNDNKSKTLKCSTLLVVGDNSPAVEAVVECNSRLNPI    211 - 280
NTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSLGSGESPFSRSVTSN    281 - 350
QSDGTQESCESPDVLDRHQTMEVSC                                                 351 - 375
//

Text Mined References (25)

PMID Year Title
25936780 2015 NDRG3-mediated lactate signaling in hypoxia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24222185 2014 Prognostic impact of NDRG2 and NDRG3 in prostate cancer patients undergoing radical prostatectomy.
23725756 2013 NDRG3 and NDRG4, two novel tumor-related genes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21725618 2011 miR-122 inhibits viral replication and cell proliferation in hepatitis B virus-related hepatocellular carcinoma and targets NDRG3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18975380 2009 NDRG3 is an androgen regulated and prostate enriched gene that promotes in vitro and in vivo prostate cancer cell growth.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17998568 2008 Differential expression patterns of NDRG family proteins in the central nervous system.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11936845 2002 Characterization and expression of three novel differentiation-related genes belong to the human NDRG gene family.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11406283 2001 Cloning and expression pattern of the human NDRG3 gene.
11352569 2001 Characterization of the human NDRG gene family: a newly identified member, NDRG4, is specifically expressed in brain and heart.
10831399 2000 N-myc downstream-regulated gene 1 is mutated in hereditary motor and sensory neuropathy-Lom.