Property Summary

NCBI Gene PubMed Count 122
PubMed Score 142.14
PubTator Score 127.24

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (2)

AA Sequence

MAELQEVQITEEKPLLPGQTPEAAKEAELAARILLDQGQTHSVETPYGSVTFTVYGTPKPKRPAILTYHD      1 - 70
VGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTI     71 - 140
IGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGN    141 - 210
SELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDP    211 - 280
TQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLS    281 - 350
QSSESGTLSSGPPGHTMEVSC                                                     351 - 371
//