Property Summary

NCBI Gene PubMed Count 164
PubMed Score 241.94
PubTator Score 270.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (16)

Disease log2 FC p
group 4 medulloblastoma -2.700 1.6e-06
atypical teratoid/rhabdoid tumor -2.300 1.1e-07
medulloblastoma, large-cell -1.900 1.8e-03
primitive neuroectodermal tumor -1.600 2.3e-03
tuberculosis -1.200 8.0e-06
primary pancreatic ductal adenocarcinoma 1.120 2.3e-02
non-small cell lung cancer 1.095 5.3e-09
intraductal papillary-mucinous carcinoma... 1.100 5.1e-03
colon cancer -1.500 2.6e-02
lung cancer -1.100 2.9e-04
breast carcinoma -1.300 4.0e-05
fibroadenoma -1.300 2.3e-03
subependymal giant cell astrocytoma -2.200 1.5e-02
ulcerative colitis -1.100 5.0e-06
ovarian cancer 1.200 5.8e-03
Breast cancer 1.400 8.3e-04

Gene RIF (134)

PMID Text
26895766 Data suggest that, in colonic/prostatic neoplasm cells, increased expression of NDRG1 decreases activating phosphorylation of FAK and paxillin; silencing/inhibition of NDRG1 results in opposite effect and inhibits neoplasm cell migration/adhesion.
26653549 NDRG1 could increase the resistance of neuroblastoma cells to chemotherapeutic drugs, with its positive regulation on drug resistant proteins.
26534963 Data suggest that NDRG1 down-regulates expression and activation of HER1/EGFR, HER2/ERBB2, and HER3/ERBB3 in response to epidermal growth factor (EGF) ligand in pancreatic/colonic neoplasm cells.
26418878 NDRG1 inhibits stemness of colorectal cancer via down-regulation of nuclear beta-catenin and CD44
26359353 Data indicate that N-myc downstream regulated gene 1 (NDRG1) competitively bind to glycogen synthase kinase 3beta (GSK-3beta) and orphan nuclear receptor (Nur77) to prevent beta-catenin degradation.
26349604 GLI1 expression in both H441 and PW cells was associated with increased expression of NDRG1, a gene known to be downregulated by the MYC family of proteins, indicating that upregulation of NDRG1 by GLI1 is not cell-type specific.
26324937 TP53 loss leads to abnormal centrosome numbers and genomic instability mediated by NDRG1
26202882 Results show that aberrant methylation of NDRG1 promoter is an important mechanism for gene silencing, playing a major role in tumor occurrence and progression of protate cancer (Pca). Reversing this process may be used for PCa treatment.
26028238 pomegranate juice-mediated decrease in cell death in hypoxia is partially mediated by NDRG1 in BeWo cells but not in primary trophoblasts.
25860930 NDRG1 decreases phosphorylation of c-Src at Tyr416 by down-regulating EGFR expression and activation. It also affected Rac1, p130Cas, CrkII, and c-Abl. NDRG1 decreases cell migration via c-src inhibition.
25777142 Overexpression of NDRG1 inhibits human glioma proliferation and invasion via phosphoinositide 3-kinase/AKT pathways.
25712528 NDRG1 is SUMOylated at Lysine 14.SUMO modification destabilizes the protein stability of NDRG1.
25520514 Microarray analyses of cellular gene expression identified N-myc downstream regulated gene 1 (NDRG1) as a putative target of Epstein-Barr virus BamHI A rightward transcripts (BART) locus miRNAs.
25335733 Variants of NDRG1 mRNA were transcriptionally regulated after HepG2 and MCF-7 cells were treated by iron chelators, resulting in domination of NDRG1 mRNA Variant 1 (V1) in the HepG2 calls and domination of NDRG1 mRNA Variant 2 (V2) in the MCF-7 cells
25218595 Knockdown of NDRG1 enhanced F-actin expression.
25162997 NDRG1 as a molecular target to inhibit the epithelial-mesenchymal transition: the case for developing inhibitors of metastasis--{review}
25152373 A functional link between SET-mediated NDRG1 regulation.
25110805 no significant difference in serum levels between pre-eclampsia and normotensive
25081069 miR-769-3p can functionally regulate NDRG1 during changes in oxygen concentration.
24985974 Down-regulation of NDRG1 in gastric cancer metastatic progression was correlated to E-cadherin and MMP-9. NDRG1 acts as a tumor suppressor gene.
24970329 NDRG1 silencing in human pancreatic cancer cells leads to a phenotype with more aggressive tumor growth and metastasis.
24829151 NDRG1 is shown to modulate the WNT-beta-catenin pathway by inhibiting the nuclear translocation of beta-catenin.
24747552 NDR1 has been activated by Thr444 phosphorylation, the activities of hMOB1 and MST1 are not required anymore to maintain elevated NDR1 kinase activity and for NDR1 to support centrosome overduplication.
24626771 NDRG1 acts as a tumor suppressor in ovarian carcinogenesis and may be a potential therapeutic target in this disease.
24532803 the role of NDRG1 as an autophagic inhibitor that is important for understanding its mechanism of action.
24498060 Results suggest that N-myc downstream-regulated gene 1 (NDRG1) may have roles connected to vesicle transport.
24386364 BTF3, HINT1, NDRG1 and ODC1 protein over-expression in human prostate cancer tissue
24367102 NDRG1 has a role in MGMT-dependent resistance to alkylating chemotherapy in glioma and glioblastoma
24302615 study demonstrated that NDRG1 is a potential therapeutic target for HCC because its suppression triggers senescence of HCC cells through activating glycogen synthase kinase-3beta-p53 pathway, thereby inhibiting tumor progression
24136616 a ~6.25 kb homozygous intragenic duplication in NDRG1, intragenic copy-number variation resulted in a homozygous duplication of exons 6-8 that caused decreased mRNA expression of NDRG1
23999030 These findings suggest that nuclear NDRG1 has tumor suppressive effects, and the NDRG1 expression may have clinical values in ccRCC.
23996628 We detected mutation in the NDRG1 gene in two families and mutation in the HK1 gene in the other two families. These mutations cause Charcot-Marie-Tooth Disease, Type 4D and Charcot-Marie-Tooth disease, type 4g, respectively.
23973486 Nuclear NDRG1 expression in colorectal neoplasms was significantly higher than in the normal colorectal mucosa, and yet the normal colorectal mucosa showed no nuclear expression.
23899187 These findings suggest that the DNA methylation status of NDRG1 gene may play an important role in the pathogenesis and/or development of breast cancer
23874837 The results suggest that miR-182 plays an important role in the proliferation of human prostate cancer cells by directly suppressing the tumor supressor gene NDRG1.
23874544 NDRG1 is a novel favorable predictor for the prognosis in CRC patients.
23846687 activation of JNK/AP-1 thus seems to promote tumor angiogenesis in relationship to NDRG1-induced inflammatory stimuli by gastric cancer cells.
23813961 NDRG1 is a novel regulator of multivesicular body formation and endosomal LDL receptor trafficking. The deficiency of functional NDRG1 in Charcot-Marie-Tooth disease type 4D might impair lipid processing and differentiation of myelinating cells.
23671130 this review summarizes the underlying molecular mechanisms of the antimetastatic effects of NDRG1 in cancer cells.
23634903 Sequence analysis predicted a pseudotrypsin protease cleavage site between Cys49-Gly50. Such cleavage of NDRG1 in cancer cells may result in loss of NDRG1 tumour suppressive activity.
23526365 HIF-1alpha up-regulates NDRG1 expression through binding to NDRG1 promoter, leading to proliferation of lung cancer A549 cells.
23437357 NDRG1 is regulated by eukaryotic initiation factor 3a (eIF3a) during cellular stress caused by iron depletion.
23377825 Our results suggest that CTAB and irinotecan could be further explored for their potential clinical benefit in patients with NDRG1 deficient PCa.
23296375 Low NDRG1 expression is a significant and independent prognostic indicator in neuroblastoma by multivariate analysis.
23192272 NDRG1 may play positive but dispensable roles in the progression of esophageal squamous cell carcinoma.
23188716 NDRG1 inhibited an important regulatory pathway mediated by ROCK1/pMLC2 pathway that modulates stress fiber assembly.
23099645 Loss of NDRG1 expression may contribute to gastric cancer development or progression.
22978647 Data indicate that the most frequent form is SH3TC2 gene (CMT4C; 57.14%), followed by HK1 gene causative of CMT4G (CMT4G/HMSN-Russe 25%) and NDRG1 p.R148X in CMT type 4D (CMT4D/HMSN-Lom; 17.86%).
22972152 NDRG1 plays a metastasis suppressor role in oral and oropharyngeal squamous cell carcinomas.
22844455 NDRG1 plays its pivotal role in the malignant progression of gastric cancer through epithelial mesenchymal transition
22722710 Data indicate that NDRG1/Cap43 overexpression may be of predictive value in determining the prognosis of lung cancer patients.
22678098 Overexpression of NDRG1 in Ishikawa cells greatly inhibited cell proliferation and migration.
22481237 Loss of NDRG1 is associated with tumor angiogenesis in lung cancer.
22462691 The iron-regulated metastasis suppressor NDRG1 targets NEDD4L, PTEN, and SMAD4 and inhibits the PI3K and Ras signaling pathways.
22453918 chelators inhibit the TGF-beta-induced EMT via a process consistent with NDRG1 up-regulation and elucidates the mechanism of their activity.
22187533 Results suggest that N-myc downstream regulated gene-1 expression is enhanced by 3,3'-diindolylmethane in poorly differentiated cells and followed by induction of apoptosis.
21976667 a link between (*)NO, chelatable iron, and regulation of NDRG1 expression and signaling in tumor cells.
21912630 Upon reoxygenation, overexpression of NDRG1 significantly inhibited cell migration
21909787 Data suggest that NDRG1 expression might participate in the carcinogenesis and progression of invasive breast cancer, and may serve as an important biomarker for invasive breast cancer.
21784644 Tissue samples from four patients with central neurocytoma (CN) have nuclear and cytoplasmic/membranous expression of NDRG1 protein in highly differentiated CN tumor cells.
21775055 Data suggest that NDRG1/Cap43 might play a key role in the cell cycle control of G0/G1 in HCC cells.
21763068 Results suggested that NDRG1 was an important molecule in controlling HCC metastasis and thus suggested as a novel biomarker for predicting HCC recurrence after LT.
21735144 our findings suggest that NDRG1 expression could be used as a novel prognostic factor for patient survival and might be a potential therapeutic target in primary gallbladder carcinoma
21708134 this work demonstrates that NDRG1 phosphorylation, by the protein kinase SGK1, is temporally and spatially controlled during the cell cycle, suggesting a role for NDRG1 in successful mitosis.
21706236 NDRG1 was upregulated in osteosarcoma
21575456 As2O3 and ATRA down-regulated the expression of NDRG-1 in HeLa cells.
21463610 These results suggest that regulation of invasion and metastasis by NDRG1 is a highly complicated process.
21454613 KAI1 gene is engaged in NDRG1 gene-mediated metastasis suppression through the ATF3-NFkappaB complex in human prostate cancer.
21236457 NDRG1 completely inhibits growth in anchorage-independent assays and in vivo supports a biological function as a tumor suppressor in pancreatic cancer.
21221878 Low NDRG1 expression is associated with breast cancer.
21184144 NDRG1 plays vital roles in tumor metastasis suppression and is frequently silenced in metastatic colon cancers.
21181370 Up-regulated NDRG1 may play a role in the suppression of malignant cell growth, invasion and metastasis of human cervical cancer.
21052891 Downregulation of NDRG1 promotes invasion of human gastric cancer through MMP-2.
20853080 Increased NDRG1 expression is associated with advanced T stages and poor vascularization in non-small cell lung cancer.
20664979 NDRG1/Cap43 promotes differentiation and invasion in osteosarcoma cells.
20573444 The selective interruption of NDRG1 signaling may prove to be therapeutically useful in HCCs, particularly in the advanced infiltrative type of tumors exposed to hypoxic environments.
20416281 Phosphorylation of NDRG1/Cap43 at both serine330 and threonine346 is required for its suppressive action on the NF-kappaB signaling pathway and CXC chemokine expression in pancreatic cancer cells.
20403915 Observational study of gene-disease association. (HuGE Navigator)
20388062 NDRG1 plays a significant role in carcinogenesis and preventing the metastasis and invasion of gastric cancer cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20369286 NDRG1 over-expression is associated with breast cancer.
20348948 Data identify a novel mechanism for TBX2-driven oncogenesis and highlight the importance of NDRG1 as a growth control gene in breast tissue.
20173668 These findings indicate that NDRG1 gene reactivation in PaCa cell lines by pharmacologic reversal of DNA methylation and histone deacetylation occurs via an indirect mechanism.
19800102 NDRG1/Cap43 could be a novel marker for malignant progression and poor prognosis in prostate cancer, plausibly in its close association with the down-regulation of E-cadherin expression.
19775754 we found significantly higher NDRG1 mRNA levels in granulocytes of healthy donors than in primary acute myeloid leukemia (AML) cells
19760510 Silencing of NDRG1 decreased endothelial cell migration.
19682504 NDRG1 is not a classic client protein but interacts with Hsp90 and is still dually regulated by Hsp90 at a transcriptional and post-translational level. We suggest for the first time GSK3beta as a new client protein of Hsp90.
19649210 This study demonstrates that most ERG-overexpressing prostate cancers harbor hormonally regulated TMPRSS2-ERG, SLC45A3-ERG, or NDRG1-ERG fusions
19491262 study suggests a novel mechanism by which NDRG1/Cap43 modulates tumor angiogenesis/growth and infiltration of macrophages/neutrophils through attenuation of NF-kappaB signaling
19414333 Overexpression of Cap43 is associated with malignant status of esophageal cancer
19337694 Decreased expression of NDRG1 in glioma is related to tumor progression.
19259744 the present study provides for the first time that the NDRG1 mRNA level is statistically significantly correlated with lymph node metastases, metastases to distant organs, and the degree of tumor cells differentiation.
19082468 NDRG1 represents an additional diagnostic marker for brain tumor detection
19046768 the role of NDRG1 protein in myeloid leukemic cell differentiation.
19020710 NDRG1/Cap43 may have a role in portal vein invasion and intrahepatic metastasis in human hepatocellular carcinoma
18977241 Observational study of gene-disease association. (HuGE Navigator)
18653908 Data suggest that alteration of PTEN may upregulate NDRG1, which may be an important gene in facilitating endometrium carcinogenesis.
18602353 Localization of N-myc downstream-regulated gene 1 and its significant correlation with p53 expression may play an important role in gastric cancer progression.
18582504 Ndrg-1 reduced the protein levels of cathepsin C which plays a role in invasion, indicating a potential mechanism of its anti-metastatic role in pancreatic cancer cells
18455888 our results demonstrate that, in common with NDRG2, human NDRG1 can be indirectly transcriptionally down-regulated by Myc via interaction with the NDRG1 core promoter.
18377423 Development of endometrial carcinoma is associated with an overexpression of NDRG1 and the loss of PTEN expression.
17909017 Egr-1 regulates NDRG1 transcription through an overlapping Egr-1/Sp1 binding site that acts as a major site of positive regulation of the NDRG1 promoter by hypoxia signaling.
17786215 NDRG1 knockdown cells show a delay in recycling transferrin, conversely NDRG1 overexpressing cells reveal an increase in rate of transferrin recycling
17786215 The N-myc down regulated Gene1 (NDRG1) is a Rab4a effector involved in vesicular recycling of E-cadherin.
17601350 Observational study of gene-disease association. (HuGE Navigator)
17569115 NDRG1 expression was correlated with various clinicopathological features and clinical outcomes in colorectal cancer depending on the race/ethnicity of the patients.
17488873 NDRG1 mRNA remains associated with polysomes during hypoxia.
17316623 hypoxia is a potent inducer of NDRG1 in HCCs, albeit requiring additional stimuli within the tumour microenvironment for its recruitment to the membrane
17220478 identified 58 proteins that interact with NDRG1 in prostate cancer cells
17069588 Decreased expression of NDRG! mRNA expression was accompanied by the local progression of esophageal squamous cell carcinoma.
16920733 The discovery that iron chelators also increase Ndrg-1 expression further augments their antitumor activity and provides a novel strategy for the treatment of cancer and its metastasis. [REVIEW]
16832411 NDRG1 will not serve as a reliable marker of tumour cells in the pancreas, but may serve as a marker of differentiation.
16778198 Analysis of specimens from 65 patients with pancreatic ductal adenocarcinoma showed a significant association between Cap43 expression and tumor microvascular density, depth of invasion, and histopathologic grading.
16707596 E2-induced down-regulation of Cap43 seems to be mediated through ER-alpha-dependent pathways in breast cancer cells both in culture and in patients
16622835 NDRG1 was up-regulated in differentiated leukemic cells after hypoxia or CoCl2 treatment via HIF-1a, which was reported involved in cell differentiation. The results indicated NDRG1 might play important role in the regulation of cell differentiation.
16314423 NDRG1 interacts with SIRT1/p53 signaling to attenuate hypoxic injury in human trophoblasts
16288478 Collectively these findings establish the importance of intracellular ascorbate levels for the regulation of expression of CA IX and NDRG1/Cap43.
15922294 NDRG1 interacts with APO A-I and A-II and may have a role in the general mechanisms of HDL-mediated cholesterol transport
15867226 Drg1 expression may be associated with a less aggressive, indolent colorectal cancer.
15582665 Two related serine-threonine kinases, nuclear Dbf2 related 1 (NDR1) and NDR2, are incorporated into HIV-1 particles and are cleaved by the HIV-1 protease (PR), both within virions and within producer cells
15461589 results identify NDRG1 and NDRG2 as physiological substrates for SGK1, and demonstrate that phosphorylation of NDRG1 by SGK1 primes it for phosphorylation by GSK3
15377670 NDRG1 is necessary but not sufficient for p53-mediated caspase activation and apoptosis
15251988 Increased Ndrg1 expression following Fe chelation was related to the permeability and antiproliferative activity of chelators. Ndrg1 up-regulation after iron chelation occurred at the transcriptional level.
15247272 Rit42 plays a role in the regulation of microtubule dynamics and the maintenance of euploidy
14966915 NDRG1 gene may play an important role in colorectal carcinogenesis
12962147 Ndrg1 gene is a Myc negative target in human neuroblastomas and other cell types with overexpressed N- or c-myc
12872253 Observational study of genotype prevalence. (HuGE Navigator)
12872253 Two disease causing mutations in NDRG1 in Charcot-Marie-Tooth Disease patients.
12767066 Downregulation of Cap43 gene by von Hippel-Lindau tumor suppressor protein in renal cancer cells.
12432451 Expression of this protein, a differentiation-related gene, has wide normal human tissue distribution and is in the SW480 colon neoplasm tumor cell line.
12429530 Cap43 overexpression in cancer cells involves a state of hypoxia characteristic of cancer cells where the Cap43 protein becomes a signature for this hypoxic state
12046693 examination as diagnostic aid due to overexpression in cancer cells
11835375 Observational study of genotype prevalence. (HuGE Navigator)
9251681 NDRG1 up-regulation during colon epithelial cell differentiation. First publication on tissue and subcellular expression of NDRG1.

AA Sequence

MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHK      1 - 70
TCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTG     71 - 140
AGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHT    141 - 210
YRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTK    211 - 280
TTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGT    281 - 350
RSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC                              351 - 394
//

Text Mined References (172)

PMID Year Title
26895766 2016 Targeting the Metastasis Suppressor, N-Myc Downstream Regulated Gene-1, with Novel Di-2-Pyridylketone Thiosemicarbazones: Suppression of Tumor Cell Migration and Cell-Collagen Adhesion by Inhibiting Focal Adhesion Kinase/Paxillin Signaling.
26653549 2015 NDRG1 promotes the multidrug resistance of neuroblastoma cells with upregulated expression of drug resistant proteins.
26534963 2016 The Metastasis Suppressor, N-MYC Downstream-regulated Gene-1 (NDRG1), Down-regulates the ErbB Family of Receptors to Inhibit Downstream Oncogenic Signaling Pathways.
26418878 2015 The metastasis suppressor, NDRG1, inhibits "stemness" of colorectal cancer via down-regulation of nuclear ?-catenin and CD44.
26359353 2015 NDRG1 promotes growth of hepatocellular carcinoma cells by directly interacting with GSK-3? and Nur77 to prevent ?-catenin degradation.
26349604 2015 Role of GLI1 and NDRG1 in Increased Resistance to Apoptosis Induction.
26324937 2015 NDRG1 links p53 with proliferation-mediated centrosome homeostasis and genome stability.
26202882 2015 Downregulation of N-myc downstream regulated gene 1 caused by the methylation of CpG islands of NDRG1 promoter promotes proliferation and invasion of prostate cancer cells.
26028238 2015 N-myc downstream-regulated gene 1 (NDRG1) mediates pomegranate juice protection from apoptosis in hypoxic BeWo cells but not in primary human trophoblasts.
25860930 2015 The proto-oncogene c-Src and its downstream signaling pathways are inhibited by the metastasis suppressor, NDRG1.
25777142 2015 Overexpression of N-myc downstream-regulated gene 1 inhibits human glioma proliferation and invasion via phosphoinositide 3-kinase/AKT pathways.
25712528 2015 SUMO modification regulates the protein stability of NDRG1.
25520514 2015 Clustered microRNAs of the Epstein-Barr virus cooperatively downregulate an epithelial cell-specific metastasis suppressor.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25335733 2014 The anticancer effects of desferrioxamine on human breast adenocarcinoma and hepatocellular carcinoma cells.
25218595 2014 N-myc downstream-regulated gene 1 downregulates cell proliferation, invasiveness, and tumorigenesis in human oral squamous cell carcinoma.
25162997 2014 NDRG1 as a molecular target to inhibit the epithelial-mesenchymal transition: the case for developing inhibitors of metastasis.
25152373 2014 SET-mediated NDRG1 inhibition is involved in acquisition of epithelial-to-mesenchymal transition phenotype and cisplatin resistance in human lung cancer cell.
25110805 2014 Increased serum heme oxygenase-1 levels as a diagnostic marker of oxidative stress in preeclampsia.
25081069 2014 MicroRNA-769-3p down-regulates NDRG1 and enhances apoptosis in MCF-7 cells during reoxygenation.
24985974 2014 NDRG1 expression is related to the progression and prognosis of gastric cancer patients through modulating proliferation, invasion and cell cycle of gastric cancer cells.
24970329 2014 The silencing of N-myc downstream-regulated gene-1 in an orthotopic pancreatic cancer model leads to more aggressive tumor growth and metastases.
24829151 2014 The metastasis suppressor NDRG1 modulates the phosphorylation and nuclear translocation of ?-catenin through mechanisms involving FRAT1 and PAK4.
24747552 2014 Constitutively active NDR1-PIF kinase functions independent of MST1 and hMOB1 signalling.
24626771 2014 N-myc downstream regulated gene 1 acts as a tumor suppressor in ovarian cancer.
24532803 2014 The metastasis suppressor, N-myc downstream-regulated gene 1 (NDRG1), inhibits stress-induced autophagy in cancer cells.
24498060 2014 Global gene expression analysis reveals a link between NDRG1 and vesicle transport.
24386364 2013 Quantitative analysis of BTF3, HINT1, NDRG1 and ODC1 protein over-expression in human prostate cancer tissue.
24367102 2014 mTOR target NDRG1 confers MGMT-dependent resistance to alkylating chemotherapy.
24302615 2014 Suppressing N-Myc downstream regulated gene 1 reactivates senescence signaling and inhibits tumor growth in hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24136616 2014 Exonic duplication CNV of NDRG1 associated with autosomal-recessive HMSN-Lom/CMT4D.
23999030 2013 Proteomics identified nuclear N-myc downstream-regulated gene 1 as a prognostic tissue biomarker candidate in renal cell carcinoma.
23996628 2013 Founder mutations in NDRG1 and HK1 genes are common causes of inherited neuropathies among Roma/Gypsies in Slovakia.
23973486 2013 Correlation of N-myc downstream-regulated gene 1 subcellular localization and lymph node metastases of colorectal neoplasms.
23899187 2013 Aberrant NDRG1 methylation associated with its decreased expression and clinicopathological significance in breast cancer.
23874837 2013 Overexpressed microRNA-182 promotes proliferation and invasion in prostate cancer PC-3 cells by down-regulating N-myc downstream regulated gene 1 (NDRG1).
23874544 2013 The metastasis suppressor, N-myc downregulated gene 1 (NDRG1), is a prognostic biomarker for human colorectal cancer.
23846687 2013 N-myc downstream-regulated gene 1 promotes tumor inflammatory angiogenesis through JNK activation and autocrine loop of interleukin-1? by human gastric cancer cells.
23813961 2013 NDRG1 functions in LDL receptor trafficking by regulating endosomal recycling and degradation.
23726511 2013 Genome-wide association study identifies new susceptibility loci for posttraumatic stress disorder.
23671130 2013 Metastasis suppressor, NDRG1, mediates its activity through signaling pathways and molecular motors.
23634903 2013 Proteolytic cleavage and truncation of NDRG1 in human prostate cancer cells, but not normal prostate epithelial cells.
23526365 2013 HIF-1? up-regulates NDRG1 expression through binding to NDRG1 promoter, leading to proliferation of lung cancer A549 cells.
23437357 2013 N-myc downstream regulated 1 (NDRG1) is regulated by eukaryotic initiation factor 3a (eIF3a) during cellular stress caused by iron depletion.
23377825 2013 Identification of cetrimonium bromide and irinotecan as compounds with synthetic lethality against NDRG1 deficient prostate cancer cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23296375 2013 Low NDRG1 mRNA expression predicts a poor prognosis in neuroblastoma patients.
23192272 2013 Oncogenic but non-essential role of N-myc downstream regulated gene 1 in the progression of esophageal squamous cell carcinoma.
23188716 2013 Targeting the metastasis suppressor, NDRG1, using novel iron chelators: regulation of stress fiber-mediated tumor cell migration via modulation of the ROCK1/pMLC2 signaling pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23099645 2013 Association of NDRG1 gene promoter methylation with reduced NDRG1 expression in gastric cancer cells and tissue specimens.
22978647 2013 Genetics of the Charcot-Marie-Tooth disease in the Spanish Gypsy population: the hereditary motor and sensory neuropathy-Russe in depth.
22972152 2012 Prognostic significance of NDRG1 expression in oral and oropharyngeal squamous cell carcinoma.
22844455 2012 N-myc downstream regulated gene 1 (NDRG1) promotes metastasis of human scirrhous gastric cancer cells through epithelial mesenchymal transition.
22722710 2012 NDRG1/Cap43 overexpression in tumor tissues and serum from lung cancer patients.
22678098 2012 N-myc downstream-regulated gene 1/Cap43 may function as tumor suppressor in endometrial cancer.
22481237 2012 NDRG1/Cap43/Drg-1 may predict tumor angiogenesis and poor outcome in patients with lung cancer.
22462691 2013 The iron-regulated metastasis suppressor NDRG1 targets NEDD4L, PTEN, and SMAD4 and inhibits the PI3K and Ras signaling pathways.
22453918 2012 The iron chelators Dp44mT and DFO inhibit TGF-?-induced epithelial-mesenchymal transition via up-regulation of N-Myc downstream-regulated gene 1 (NDRG1).
22187533 2012 The indolic diet-derivative, 3,3'-diindolylmethane, induced apoptosis in human colon cancer cells through upregulation of NDRG1.
21976667 2011 Nitric oxide suppresses tumor cell migration through N-Myc downstream-regulated gene-1 (NDRG1) expression: role of chelatable iron.
21912630 2011 Down-regulation of NDRG1 promotes migration of cancer cells during reoxygenation.
21909787 2011 Increased N-myc downstream-regulated gene 1 expression is associated with breast atypia-to-carcinoma progression.
21784644 2011 Expression of N-myc downstream regulated gene 1 (NDRG1) in central neurocytoma.
21775055 2011 N-myc downstream regulated gene1/Cap43 overexpression suppresses tumor growth by hepatic cancer cells through cell cycle arrest at the G0/G1 phase.
21763068 2011 NDRG1 as a biomarker for metastasis, recurrence and of poor prognosis in hepatocellular carcinoma.
21735144 2012 Expression of N-myc downstream-regulated gene 1 in primary gallbladder carcinoma and its correlation with clinicopathological features and clinical outcome.
21708134 2011 Phosphorylation of NDRG1 is temporally and spatially controlled during the cell cycle.
21706236 2011 Plasma membrane proteomic analysis of human osteosarcoma and osteoblastic cells: revealing NDRG1 as a marker for osteosarcoma.
21575456 2011 [Effects of As2O3 and all-trans retinoic acid on the growth of HeLa cell line and their relation with gene NDRG1].
21463610 2011 Identification of NDRG1-regulated genes associated with invasive potential in cervical and ovarian cancer cells.
21454613 2011 KAI1 gene is engaged in NDRG1 gene-mediated metastasis suppression through the ATF3-NFkappaB complex in human prostate cancer.
21269460 2011 Initial characterization of the human central proteome.
21236457 2011 N-myc downstream regulated gene-1 expression correlates with reduced pancreatic cancer growth and increased apoptosis in vitro and in vivo.
21221878 2011 N-myc downstream-regulated gene 1 (NDRG1) a differentiation marker of human breast cancer.
21184144 2011 Transcriptional silencing of N-Myc downstream-regulated gene 1 (NDRG1) in metastatic colon cancer cell line SW620.
21181370 2010 Expression and biological function of N-myc down-regulated gene 1 in human cervical cancer.
21052891 2011 Downregulation of NDRG1 promotes invasion of human gastric cancer AGS cells through MMP-2.
20853080 2012 Increased NDRG1 expression is associated with advanced T stages and poor vascularization in non-small cell lung cancer.
20810912 2010 Hypoxia downregulates p53 but induces apoptosis and enhances expression of BAD in cultures of human syncytiotrophoblasts.
20664979 2010 N-myc downstream-regulated gene 1/Cap43 expression promotes cell differentiation of human osteosarcoma cells.
20573444 2010 Hypoxia and retinoic acid-inducible NDRG1 expression is responsible for doxorubicin and retinoic acid resistance in hepatocellular carcinoma cells.
20416281 2010 Identification of sites subjected to serine/threonine phosphorylation by SGK1 affecting N-myc downstream-regulated gene 1 (NDRG1)/Cap43-dependent suppression of angiogenic CXC chemokine expression in human pancreatic cancer cells.
20403915 2010 Single nucleotide polymorphisms in Wnt signaling and cell death pathway genes and susceptibility to colorectal cancer.
20388062 2010 A novel molecular marker for early detection and evaluating prognosis of gastric cancer: N-myc downstream regulated gene-1 (NDRG1).
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20369286 2011 Prognostic value of NDRG1 and SPARC protein expression in breast cancer patients.
20348948 2010 T-box 2 represses NDRG1 through an EGR1-dependent mechanism to drive the proliferation of breast cancer cells.
20173668 2010 Epigenetic regulation affects N-myc downstream-regulated gene 1 expression indirectly in pancreatic cancer cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19800102 2010 N-myc downstream regulated gene-1/Cap43 may play an important role in malignant progression of prostate cancer, in its close association with E-cadherin.
19775754 2010 NDRG1/2 expression is inhibited in primary acute myeloid leukemia.
19760510 2009 NDRG1 and CRK-I/II are regulators of endothelial cell migration under Intermittent Hypoxia.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19682504 2009 Hsp90 transcriptionally and post-translationally regulates the expression of NDRG1 and maintains the stability of its modifying kinase GSK3beta.
19649210 2009 N-myc downstream regulated gene 1 (NDRG1) is fused to ERG in prostate cancer.
19491262 2009 N-myc downstream regulated gene 1/Cap43 suppresses tumor growth and angiogenesis of pancreatic cancer through attenuation of inhibitor of kappaB kinase beta expression.
19414333 2009 Overexpression of Cap43 is associated with malignant status of esophageal cancer.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19337694 2009 Decreased expression of NDRG1 in glioma is related to tumor progression and survival of patients.
19259744 2009 Identification of high-risk stage II colorectal tumors by combined analysis of the NDRG1 gene expression and the depth of tumor invasion.
19082468 2009 Oxygen-dependent regulation of NDRG1 in human glioblastoma cells in vitro and in vivo.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19046768 2009 NDRG1 contributes to retinoic acid-induced differentiation of leukemic cells.
19020710 2008 N-myc downstream regulated gene 1 (NDRG1)/Cap43 enhances portal vein invasion and intrahepatic metastasis in human hepatocellular carcinoma.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18787837 2009 SGK1 activity in Na+ absorbing airway epithelial cells monitored by assaying NDRG1-Thr346/356/366 phosphorylation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18653908 2008 N-myc downstream-regulated gene 1 as a downregulated target gene of PTEN in the controlling of tumourigenesis in endometrioid carcinoma.
18602353 2009 Localization of N-myc downstream-regulated gene 1 in gastric cancer tissue.
18582504 2008 The iron-regulated metastasis suppressor, Ndrg-1: identification of novel molecular targets.
18455888 2008 Human differentiation-related gene NDRG1 is a Myc downstream-regulated gene that is repressed by Myc on the core promoter region.
18377423 2008 Correlation between NDRG1 and PTEN expression in endometrial carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17909017 2007 Egr-1 mediates hypoxia-inducible transcription of the NDRG1 gene through an overlapping Egr-1/Sp1 binding site in the promoter.
17786215 2007 The N-Myc down regulated Gene1 (NDRG1) Is a Rab4a effector involved in vesicular recycling of E-cadherin.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17569115 2007 Correlation of N-myc downstream-regulated gene 1 expression with clinical outcomes of colorectal cancer patients of different race/ethnicity.
17488873 2007 Identification of mRNAs that continue to associate with polysomes during hypoxia.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17316623 2007 Hypoxia increases cytoplasmic expression of NDRG1, but is insufficient for its membrane localization in human hepatocellular carcinoma.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17069588 2006 Decreased expression of NDRG1 is correlated with tumor progression and poor prognosis in patients with esophageal squamous cell carcinoma.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16920733 2006 The metastasis suppressor, Ndrg-1: a new ally in the fight against cancer.
16832411 2006 Cellular differentiation determines the expression of the hypoxia-inducible protein NDRG1 in pancreatic cancer.
16778198 2006 Tumor growth suppression in pancreatic cancer by a putative metastasis suppressor gene Cap43/NDRG1/Drg-1 through modulation of angiogenesis.
16707596 2006 17Beta-estradiol induces down-regulation of Cap43/NDRG1/Drg-1, a putative differentiation-related and metastasis suppressor gene, in human breast cancer cells.
16622835 2006 Comparative proteomic analysis of hypoxia-treated and untreated human leukemic U937 cells.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16314423 2006 N-myc down-regulated gene 1 modulates the response of term human trophoblasts to hypoxic injury.
16288478 2006 Ascorbate depletion mediates up-regulation of hypoxia-associated proteins by cell density and nickel.
15922294 2005 NDRG1 interacts with APO A-I and A-II and is a functional candidate for the HDL-C QTL on 8q24.
15867226 2005 Drg1 expression in 131 colorectal liver metastases: correlation with clinical variables and patient outcomes.
15607035 2004 Systematic identification of hepatocellular proteins interacting with NS5A of the hepatitis C virus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461589 2004 Exploitation of KESTREL to identify NDRG family members as physiological substrates for SGK1 and GSK3.
15377670 2004 NDRG1 is necessary for p53-dependent apoptosis.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15251988 2004 Iron chelators with high antiproliferative activity up-regulate the expression of a growth inhibitory and metastasis suppressor gene: a link between iron metabolism and proliferation.
15247272 2004 Function of Drg1/Rit42 in p53-dependent mitotic spindle checkpoint.
14966915 2004 Correlation of N-myc downstream-regulated gene 1 overexpression with progressive growth of colorectal neoplasm.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12962147 2003 The growth-inhibitory Ndrg1 gene is a Myc negative target in human neuroblastomas and other cell types with overexpressed N- or c-myc.
12872253 2003 Mutation screening of the N-myc downstream-regulated gene 1 (NDRG1) in patients with Charcot-Marie-Tooth Disease.
12767066 2003 Downregulation of Cap43 gene by von Hippel-Lindau tumor suppressor protein in human renal cancer cells.
12702552 2003 The Drg-1 gene suppresses tumor metastasis in prostate cancer.
12493777 2003 Mechanism of Ca2+-mediated regulation of NDR protein kinase through autophosphorylation and phosphorylation by an upstream kinase.
12483528 2002 Androgen-induced expression of endoplasmic reticulum (ER) stress response genes in prostate cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12432451 2002 Expression of NDRG1, a differentiation-related gene, in human tissues.
12429530 2002 Enhanced overexpression of an HIF-1/hypoxia-related protein in cancer cells.
12046693 2002 Enhanced expression of a novel protein in human cancer cells: a potential aid to cancer diagnosis.
11936845 2002 Characterization and expression of three novel differentiation-related genes belong to the human NDRG gene family.
11835375 2002 Charcot-Marie-Tooth disease and related neuropathies: mutation distribution and genotype-phenotype correlation.
11352569 2001 Characterization of the human NDRG gene family: a newly identified member, NDRG4, is specifically expressed in brain and heart.
11237058 2001 The leukemogenic transcription factor E2a-Pbx1 induces expression of the putative N-myc and p53 target gene NDRG1 in Ba/F3 cells.
11006124 2000 Hypoxia induces the expression of a 43-kDa protein (PROXY-1) in normal and malignant cells.
10860807 2000 Phosphorylation of RTP, an ER stress-responsive cytoplasmic protein.
10831399 2000 N-myc downstream-regulated gene 1 is mutated in hereditary motor and sensory neuropathy-Lom.
10676663 2000 Drg-1 as a differentiation-related, putative metastatic suppressor gene in human colon cancer.
10395947 1999 Differential expression of the RTP/Drg1/Ndr1 gene product in proliferating and growth arrested cells.
9766676 1998 Inhibition of tumor cell growth by RTP/rit42 and its responsiveness to p53 and DNA damage.
9605764 1998 Cap43, a novel gene specifically induced by Ni2+ compounds.
9251681 1997 A novel gene which is up-regulated during colon epithelial cell differentiation and down-regulated in colorectal neoplasms.
8939898 1996 Homocysteine-respondent genes in vascular endothelial cells identified by differential display analysis. GRP78/BiP and novel genes.
8841199 1996 Gene mapping in Gypsies identifies a novel demyelinating neuropathy on chromosome 8q24.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.