Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.05
PubTator Score 9.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
breast carcinoma 1614 1.8e-02

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.700 1.8e-02

Gene RIF (4)

PMID Text
23596212 the molecular basis of recognition between Ndor1 and anamorsin and of the electron transfer process, was investigated.
21152063 Data show that that all seven currently known NMDAR subunits (NR1, NR2A, NR2B, NR2C, NR2D, NR3A and NR3B) are expressed in astrocytes, but at different levels.
12871938 NR1 may represent a minor pathway in the cell for redox regulation of methionine synthase
12631275 characterized in detail the redox and electron transfer properties of the component flavin-binding domains of protein NR1

AA Sequence

MPSPQLLVLFGSQTGTAQDVSERLGREARRRRLGCRVQALDSYPVVNLINEPLVIFVCATTGQGDPPDNM      1 - 70
KNFWRFIFRKNLPSTALCQMDFAVLGLGDSSYAKFNFVAKKLHRRLLQLGGSALLPVCLGDDQHELGPDA     71 - 140
AVDPWLRDLWDRVLGLYPPPPGLTEIPPGVPLPSKFTLLFLQEAPSTGSEGQRVAHPGSQEPPSESKPFL    141 - 210
APMISNQRVTGPSHFQDVRLIEFDILGSGISFAAGDVVLIQPSNSAAHVQRFCQVLGLDPDQLFMLQPRE    211 - 280
PDVSSPTRLPQPCSMRHLVSHYLDIASVPRRSFFELLACLSLHELEREKLLEFSSAQGQEELFEYCNRPR    281 - 350
RTILEVLCDFPHTAAAIPPDYLLDLIPVIRPRAFSIASSLLTHPSRLQILVAVVQFQTRLKEPRRGLCSS    351 - 420
WLASLDPGQGPVRVPLWVRPGSLAFPETPDTPVIMVGPGTGVAPFRAAIQERVAQGQTGNFLFFGCRWRD    421 - 490
QDFYWEAEWQELEKRDCLTLIPAFSREQEQKVYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVS    491 - 560
EALMSIFQEEGGLCSPDAAAYLARLQQTRRFQTETWA                                     561 - 597
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23596212 2013 Molecular view of an electron transfer process essential for iron-sulfur protein biogenesis.
21269460 2011 Initial characterization of the human central proteome.
21152063 2010 Characterisation of the expression of NMDA receptors in human astrocytes.
20802492 2010 Tah18 transfers electrons to Dre2 in cytosolic iron-sulfur protein biogenesis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16140270 2005 Role of a novel dual flavin reductase (NR1) and an associated histidine triad protein (DCS-1) in menadione-induced cytotoxicity.
15900210 2005 Identification of a functionally impaired allele of human novel oxidoreductase 1 (NDOR1), NDOR1*1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12871939 2003 Coordinate expression of NADPH-dependent flavin reductase, Fre-1, and Hint-related 7meGMP-directed hydrolase, DCS-1.
12871938 2003 Redundancy in the pathway for redox regulation of mammalian methionine synthase: reductive activation by the dual flavoprotein, novel reductase 1.
12631275 2003 Determination of the redox potentials and electron transfer properties of the FAD- and FMN-binding domains of the human oxidoreductase NR1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10625700 2000 Cloning and characterization of a novel human dual flavin reductase.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.