Property Summary

NCBI Gene PubMed Count 8
PubMed Score 231.49
PubTator Score 14.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 2.055 4.7e-02
malignant mesothelioma -4.600 4.2e-09
medulloblastoma, large-cell 1.100 2.0e-03
non-small cell lung cancer -2.820 7.6e-16
colon cancer -2.300 1.5e-02
lung cancer -4.300 5.8e-07
pancreatic cancer 1.100 1.3e-03
interstitial cystitis -2.600 2.3e-04
lung adenocarcinoma -1.800 1.2e-07
lung carcinoma -5.000 2.0e-44
ovarian cancer -3.000 1.2e-12
pituitary cancer -3.900 1.3e-09
psoriasis -1.300 5.4e-43

Synonym

Accession Q8TB73 A8K0Q0 Q6UWE5 Q9H5P7
Symbols NORD
C4orf31

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
24706764 NDNF acts as an endogenous modulator that promotes endothelial cell function and ischemia-induced revascularization through eNOS-dependent mechanisms
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of neuron-derived neurotrophic factor (NDNF; C4orf31) in primary human brain microvascular endothelial cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20332099 Observational study of gene-disease association. (HuGE Navigator)
16970039 direct duplication of chromosome 4q27q31.3 de novo results in partial trisomy of its long arm.

AA Sequence

MVLLHWCLLWLLFPLSSRTQKLPTRDEELFQMQIRDKAFFHDSSVIPDGAEISSYLFRDTPKRYFFVVEE      1 - 70
DNTPLSVTVTPCDAPLEWKLSLQELPEDRSGEGSGDLEPLEQQKQQIINEEGTELFSYKGNDVEYFISSS     71 - 140
SPSGLYQLDLLSTEKDTHFKVYATTTPESDQPYPELPYDPRVDVTSLGRTTVTLAWKPSPTASLLKQPIQ    141 - 210
YCVVINKEHNFKSLCAVEAKLSADDAFMMAPKPGLDFSPFDFAHFGFPSDNSGKERSFQAKPSPKLGRHV    211 - 280
YSRPKVDIQKICIGNKNIFTVSDLKPDTQYYFDVFVVNINSNMSTAYVGTFARTKEEAKQKTVELKDGKI    281 - 350
TDVFVKRKGAKFLRFAPVSSHQKVTFFIHSCLDAVQIQVRRDGKLLLSQNVEGIQQFQLRGKPKAKYLVR    351 - 420
LKGNKKGASMLKILATTRPTKQSFPSLPEDTRIKAFDKLRTCSSATVAWLGTQERNKFCIYKKEVDDNYN    421 - 490
EDQKKREQNQCLGPDIRKKSEKVLCKYFHSQNLQKAVTTETIKGLQPGKSYLLDVYVIGHGGHSVKYQSK    491 - 560
VVKTRKFC                                                                  561 - 568
//

Text Mined References (10)

PMID Year Title
24706764 2014 Neuron-derived neurotrophic factor functions as a novel modulator that enhances endothelial cell function and revascularization processes.
20969804 2010 Spatio-temporal expression of a novel neuron-derived neurotrophic factor (NDNF) in mouse brains during development.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
16970039 2006 Mosaicism for terminal deletion of 4q.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.