Property Summary

NCBI Gene PubMed Count 43
PubMed Score 160.94
PubTator Score 58.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (24)

PMID Text
26518708 NDN and CD1A are novel prognostic methylation markers in patients with head and neck squamous carcinomas
26384308 Germline single nucleotide polymorphism in necdin gene is associated with breast cancer.
23549060 Hypermethylation and mutation of necdin is associated with neoplasms.
22905258 necdin exerts its pro-survival activity by counteracting the action of the pro-apoptotic protein Cell Cycle Apoptosis Regulatory Protein (CCAR1/CARP1)
22691188 Necdin expression declined during replicative aging of IMR90 primary human fibroblasts or after induction of premature senescence.Showed that in normal human cells, Necdin expression mimicked the effect of p53 inactivation by increasing radioresistance.
22442722 necdin has multiple roles within protein complexes in different subcellular compartments, and indicate that it can utilize multiple karyopherin-dependent pathways to modulate its localization.
22305984 In pre-adipocytes, necdin over-expression inhibits adipogenesis, while reducing necdin levels enhances adipogenic differentiation in tissue culture cell
22046235 Necdin, a negative growth regulator,identified as a novel STAT3 target gene, whose expression is down-regulated at the mRNA and protein levels when STAT3 is constitutively active.
21912643 Necdin is implicated through the TNF-receptor 1 pathway in the developmental death of motoneuron
21543378 rare variant of necdin (p.V318A) was described in a family with Kallmann syndrome Familial segregation and in vitro analysis suggested that this non-synonymous variant did not have a direct causative role in hypogonadism phenotype.
21150695 Data suggest that the effects of necdin deletion on the developing nervous system may depend on the relative expression of p75NTR and TrkA in the cells of particular regions of the nervous system.
20665884 Necdin is a key protein regulating polarization of the cytoskeleton and myosin activation during development.
20538960 Observational study of gene-disease association. (HuGE Navigator)
19626646 Confirmation of NDN as a tumor suppressor may have implications for monitoring of PWS patients and could present a novel cancer therapeutic target
19517793 regulates neuronal development. (review)
19386232 Data suggest that Nogo-A is a novel necdin binding protein and inhibits necdin-accelerated neuronal neurite outgrowth by sequestering necdin in the cytoplasm.
19058789 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18272695 Lack of Necdin expression induces perinatal serotonergic alterations that affect the maturation and function of the respiratory network, inducing breathing deficits in mice and probably in Prader-Willi patients.
15978586 Necdin can be a novel negative regulator of HIF-1alpha stability via the direct interaction.
15247330 Tissue-specific gene expression regulation and imprinted epigenetic modifications of the human NDN gene.
12913118 the constitutively up-regulated expression of pre-IL-1 alpha in the nuclei of systemic sclerosis (SSc) fibroblasts up-regulates proliferation and matrix production of SSC fibroblasts through binding necdin
11439287 Observational study of gene-disease association. (HuGE Navigator)
9302265 The necdin gene is imprinted, with preferential expression from the paternal allele in human and mouse.

AA Sequence

MSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAEPQSPPLGPTAAPQAAPPPQAPNDEGDPKAL      1 - 70
QQAAEEGRAHQAPSAAQPGPAPPAPAQLVQKAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSIL     71 - 140
RRTSLILARVFGLHLRLTSLHTMEFALVKALEPEELDRVALSNRMPMTGLLLMILSLIYVKGRGARESAV    141 - 210
WNVLRILGLRPWKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLA    211 - 280
RVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED                                 281 - 321
//

Text Mined References (44)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26518708 2015 NDN and CD1A are novel prognostic methylation markers in patients with head and neck squamous carcinomas.
26384308 2015 Necdin is a breast cancer metastasis suppressor that regulates the transcription of c-Myc.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
23549060 2013 Putative tumour suppressor gene necdin is hypermethylated and mutated in human cancer.
22905258 2012 Necdin enhances myoblasts survival by facilitating the degradation of the mediator of apoptosis CCAR1/CARP1.
22691188 2012 Necdin modulates proliferative cell survival of human cells in response to radiation-induced genotoxic stress.
22442722 2012 Functional consequences of necdin nucleocytoplasmic localization.
22305984 2012 Loss of the Prader-Willi obesity syndrome protein necdin promotes adipogenesis.
22046235 2011 Necdin, a negative growth regulator, is a novel STAT3 target gene down-regulated in human cancer.
21912643 2011 Necdin protects embryonic motoneurons from programmed cell death.
21543378 2011 Mutational analysis of the necdin gene in patients with congenital isolated hypogonadotropic hypogonadism.
21150695 2011 Necdin and neurotrophin receptors: interactors of relevance for neuronal resistance to oxidant stress.
20665884 2010 Loss of Necdin impairs myosin activation and delays cell polarization.
20538960 2010 A candidate gene study of obstructive sleep apnea in European Americans and African Americans.
19626646 2009 Necdin: a multi functional protein with potential tumor suppressor role?
19517793 2009 [Regulation of neuronal development by the imprinted gene Necdin].
19386232 2009 Nogo-A inhibits necdin-accelerated neurite outgrowth by retaining necdin in the cytoplasm.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18272695 2008 Necdin plays a role in the serotonergic modulation of the mouse respiratory network: implication for Prader-Willi syndrome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15978586 2005 Negative regulation of hypoxia inducible factor-1alpha by necdin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15247330 2004 Tissue-specific and imprinted epigenetic modifications of the human NDN gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14593116 2004 Necdin-related MAGE proteins differentially interact with the E2F1 transcription factor and the p75 neurotrophin receptor.
12913118 2003 A nuclear target for interleukin-1alpha: interaction with the growth suppressor necdin modulates proliferation and collagen expression.
12716928 2003 Ligand-induced internalization of the p75 neurotrophin receptor: a slow route to the signaling endosome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414813 2002 The p75 neurotrophin receptor interacts with multiple MAGE proteins.
12198120 2002 Ectopic expression of necdin induces differentiation of mouse neuroblastoma cells.
11959851 2002 A RING finger protein Praja1 regulates Dlx5-dependent transcription through its ubiquitin ligase activity for the Dlx/Msx-interacting MAGE/Necdin family protein, Dlxin-1.
11813259 2002 Necdin interacts with the ribonucleoprotein hnRNP U in the nuclear matrix.
11439287 2001 Systematic screening for mutations in the human necdin gene (NDN): identification of two naturally occurring polymorphisms and association analysis in body weight regulation.
10965153 2000 Cellular and subcellular localization of necdin in fetal and adult mouse brain.
10915798 2000 The postmitotic growth suppressor necdin interacts with a calcium-binding protein (NEFA) in neuronal cytoplasm.
10347180 1999 Physical and functional interactions of neuronal growth suppressor necdin with p53.
9630521 1998 The human chromosomal gene for necdin, a neuronal growth suppressor, in the Prader-Willi syndrome deletion region.
9422723 1998 Necdin, a postmitotic neuron-specific growth suppressor, interacts with viral transforming proteins and cellular transcription factor E2F1.
9354807 1997 The human necdin gene, NDN, is maternally imprinted and located in the Prader-Willi syndrome chromosomal region.
9302265 1997 The necdin gene is deleted in Prader-Willi syndrome and is imprinted in human and mouse.
1394972 1992 Expression of necdin, an embryonal carcinoma-derived nuclear protein, in developing mouse brain.