Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.85
PubTator Score 4.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
pancreatic cancer 1.200 4.8e-02
astrocytic glioma -1.800 1.2e-03
ependymoma -2.000 2.7e-02
glioblastoma -2.900 2.0e-07
oligodendroglioma -1.800 8.0e-20
osteosarcoma 1.942 3.9e-04
medulloblastoma -3.100 1.2e-08
atypical teratoid / rhabdoid tumor -2.900 1.5e-09
medulloblastoma, large-cell -3.100 2.8e-05
primitive neuroectodermal tumor -2.200 1.5e-05
pancreatic ductal adenocarcinoma liver m... -1.069 7.9e-03
tuberculosis and treatment for 3 months -1.800 4.2e-05
interstitial cystitis -1.700 5.4e-06
pediatric high grade glioma -2.200 8.6e-06
pilocytic astrocytoma -1.300 2.7e-04
pancreatic carcinoma 1.200 4.8e-02
lung adenocarcinoma -1.100 2.0e-07
spina bifida -2.104 4.6e-02
Pick disease -2.000 4.1e-03
Breast cancer -1.200 4.8e-12
ulcerative colitis -1.300 6.6e-05
ovarian cancer 2.000 4.3e-03
pituitary cancer 1.700 4.2e-06

Gene RIF (6)

PMID Text
26363003 Data show that membrane protein Ndfip1 recruits E3 ubiquitin (Ub) ligase Nedd4-2 to the Golgi to target ether-a-go-go-related gene (hERG) channel for degradation while membrane protein Ndfip2 also mediates Nedd4-2 interaction with hERG in the Golgi.
20534535 PTEN/Akt and MAP kinase signaling pathways are regulated by the ubiquitin ligase activators Ndfip1 and Ndfip2
19343052 Data show that the small PY-containing membrane proteins, NDFIP1 and NDFIP2 (NEDD4 family-interacting proteins), activate the catalytic activity of ITCH and of several other HECT ligases by binding to them.
15252135 N4WBP5A acts as an adaptor to recruit Nedd4 family ubiquitin-protein ligases to the protein trafficking machinery
12796489 N4WBP5A may play a regulatory role in modulating Nedd4 activity at the level of the Golgi apparatus in T lymphocytes
12050153 role in regulating epithelial sodium channel

AA Sequence

MARRRSQRVCASGPSMLNSARGAPELLRGTATNAEVSAAAAGATGSEELPPGDRGCRNGGGRGPAATTSS      1 - 70
TGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDNSESSAIEQPPTSNPAPQIVQAASSAP     71 - 140
ALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEAEKAKAAAMAAAAAETSQRIQE    141 - 210
EECPPRDDFSDADQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVR    211 - 280
FSDYFTGYFNGQYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL                  281 - 336
//

Text Mined References (16)

PMID Year Title
26363003 2015 Regulation of the human ether-a-go-go-related gene (hERG) potassium channel by Nedd4 family interacting proteins (Ndfips).
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
20686608 2010 Genome-wide association study of pancreatic cancer in Japanese population.
20534535 2010 Regulation of PTEN/Akt and MAP kinase signaling pathways by the ubiquitin ligase activators Ndfip1 and Ndfip2.
19343052 2009 Control of the activity of WW-HECT domain E3 ubiquitin ligases by NDFIP proteins.
18776082 2008 Regulation of the divalent metal ion transporter DMT1 and iron homeostasis by a ubiquitin-dependent mechanism involving Ndfips and WWP2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252135 2004 N4WBP5A (Ndfip2), a Nedd4-interacting protein, localizes to multivesicular bodies and the Golgi, and has a potential role in protein trafficking.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12796489 2003 Cloning and characterization of N4WBP5A, an inducible, cyclosporine-sensitive, Nedd4-binding protein in human T lymphocytes.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12050153 2002 Regulation of the epithelial sodium channel by N4WBP5A, a novel Nedd4/Nedd4-2-interacting protein.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.