Property Summary

NCBI Gene PubMed Count 24
PubMed Score 22.04
PubTator Score 10.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -1.400 9.8e-04
atypical teratoid / rhabdoid tumor -1.400 3.9e-05
glioblastoma -1.600 3.2e-05
medulloblastoma -1.200 3.7e-06
medulloblastoma, large-cell -2.100 1.3e-05
pancreatic ductal adenocarcinoma liver m... -2.153 7.8e-03
non-small cell lung cancer -1.183 2.6e-21
pediatric high grade glioma -1.200 1.1e-04
non primary Sjogren syndrome sicca 1.200 1.8e-02
Alzheimer's disease -1.200 4.3e-02
Pick disease -1.600 4.5e-06
invasive ductal carcinoma -1.200 5.8e-03
ovarian cancer -2.700 4.7e-11

 GO Function (1)

Pathway (1)

Gene RIF (11)

PMID Text
26363003 Data show that membrane protein Ndfip1 recruits E3 ubiquitin (Ub) ligase Nedd4-2 to the Golgi to target ether-a-go-go-related gene (hERG) channel for degradation while membrane protein Ndfip2 also mediates Nedd4-2 interaction with hERG in the Golgi.
26319551 Silencing of Ndfip1 inhibited cytokine-induced apoptosis of pancreatic islets and promoted glucose-stimulated insulin secretion. These effects were associated with an increase in the cellular content of JunB, a potent inhibitor of ER stress and apoptosis.
25631046 Ndfip1 is required during stress for ubiquitinating and trafficking BRAT1 into the nucleus.
24475238 In Parkinson's disease, increased iron levels are associated with increased Ndfip1 expression for the regulation of DMT1, including abnormal Ndfip1 activation in non-neuronal cell types such as astrocytes.
23087404 Ndfip1 negatively regulates RIG-I-dependent immune signaling by enhancing E3 ligase Smurf1-mediated MAVS degradation.
21187286 Cellular up-regulation of Nedd4 family interacting protein 1 (Ndfip1) using low levels of bioactive cobalt complexes.
20534535 PTEN/Akt and MAP kinase signaling pathways are regulated by the ubiquitin ligase activators Ndfip1 and Ndfip2
19706893 Ndfip1 plays a critical role in regulating metal transport in human neurons through its regulation of DMT1.
19343052 Data show that the small PY-containing membrane proteins, NDFIP1 and NDFIP2 (NEDD4 family-interacting proteins), activate the catalytic activity of ITCH and of several other HECT ligases by binding to them.
18854154 Knockdown of Nedd4 family interacting protein 1 (NDFIP1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18819914 Ndfip1 is required for the exosomal secretion of Nedd4 family proteins

AA Sequence

MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVA      1 - 70
TTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLT     71 - 140
TSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFS    141 - 210
NLPRTRVLFIY                                                               211 - 221
//

Text Mined References (26)

PMID Year Title
26363003 2015 Regulation of the human ether-a-go-go-related gene (hERG) potassium channel by Nedd4 family interacting proteins (Ndfips).
26319551 2015 Nedd4 family interacting protein 1 (Ndfip1) promotes death of pancreatic beta cells.
25631046 2015 Nedd4 family interacting protein 1 (Ndfip1) is required for ubiquitination and nuclear trafficking of BRCA1-associated ATM activator 1 (BRAT1) during the DNA damage response.
24475238 2014 Increased Ndfip1 in the substantia nigra of Parkinsonian brains is associated with elevated iron levels.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23087404 2012 Ndfip1 negatively regulates RIG-I-dependent immune signaling by enhancing E3 ligase Smurf1-mediated MAVS degradation.
22561531 2012 Genome-wide association study to identify genetic determinants of severe asthma.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21187286 2011 Cellular up-regulation of Nedd4 family interacting protein 1 (Ndfip1) using low levels of bioactive cobalt complexes.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20534535 2010 Regulation of PTEN/Akt and MAP kinase signaling pathways by the ubiquitin ligase activators Ndfip1 and Ndfip2.
19706893 2009 Divalent metal transporter 1 (DMT1) regulation by Ndfip1 prevents metal toxicity in human neurons.
19343052 2009 Control of the activity of WW-HECT domain E3 ubiquitin ligases by NDFIP proteins.
18819914 2008 Nedd4 family-interacting protein 1 (Ndfip1) is required for the exosomal secretion of Nedd4 family proteins.
18776082 2008 Regulation of the divalent metal ion transporter DMT1 and iron homeostasis by a ubiquitin-dependent mechanism involving Ndfips and WWP2.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11748237 2002 N4WBP5, a potential target for ubiquitination by the Nedd4 family of proteins, is a novel Golgi-associated protein.
11042109 2000 Identification of multiple proteins expressed in murine embryos as binding partners for the WW domains of the ubiquitin-protein ligase Nedd4.