Property Summary

NCBI Gene PubMed Count 64
PubMed Score 67.59
PubTator Score 66.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.800 2.6e-03
oligodendroglioma -1.300 1.7e-02
posterior fossa group B ependymoma -1.400 8.4e-07
glioblastoma -1.800 1.1e-06
medulloblastoma -1.800 2.4e-07
atypical teratoid / rhabdoid tumor -1.600 1.0e-07
medulloblastoma, large-cell -2.800 3.5e-05
primitive neuroectodermal tumor -1.300 6.5e-04
adrenocortical carcinoma -1.374 7.3e-05
pediatric high grade glioma -1.500 1.6e-07
pilocytic astrocytoma -1.600 9.7e-08
subependymal giant cell astrocytoma -1.182 3.4e-02
lung adenocarcinoma -1.100 3.8e-13
acute myeloid leukemia 1.200 2.7e-02
ovarian cancer 1.300 2.8e-03

Gene RIF (39)

PMID Text
26476704 This study observed a significantly increased myelin basic protein (MBP) and nuclear distribution protein nudE-like 1 (NDEL1) mRNA levels in FEP patients compared with controls.
24785679 study provided comprehensive documentation of the expression patterns of Nde1 and Ndel1 in cultured cells as well as in mouse and human brains, and also highlighting that dosage effects of these two proteins might contribute to some cases of mental disorder
23388542 The Plasma Ndel1 enzyme activity is reduced in patients with schizophrenia.
22843697 analysis of mixed NDE1-NDEL1 complexes demonstrates that NDE1 and NDEL1 can interact directly.
22832604 Short (DISC)1 splice variants show reduced or no binding to nudE nuclear distribution E homolog (NDEL)1 and phosphodiesterase (PDE)4B proteins, but fully interact with FEZ1 and glycogen synthase kinase 3 (GSK3)beta.
22453242 Nudel markedly promotes the HSPC300-WAVE2 interaction.
22430153 Cytosolic mfGbeta is recruited to dynein by Nudel and transported to the centrosome for rapid sequestration and degradation.
22373868 Studies indicate that binding of dynactin, LIS1 and NudEL regulate cytoplasmic dynein motor activity.
21998303 DISC1 forms octamers via dimers as building blocks. S704C forms higher-order oligomers, without affecting its affinity with NDEL1
21948775 Nuclear distribution element-like 1 (Ndel1 or Nudel) was firstly described as a regulator of the cytoskeleton in microtubule and intermediate filament dynamics and microtubule-based transport.
21092859 NDEL1 is essential for a specific late step of neuronal migration: entry into the target lamina.
21036906 The truncated monomeric form of LIS1 had little effect on dynein motility, but an artificial dimer of truncated LIS1 suppressed dynein motility, which was restored by the N-terminal fragment of NDEL1.
20462516 This data supports a physiological role for the endooligopeptidase activity of Ndel1 and suggests it plays a key role during neurite outgrowth.
20168084 Findings suggest that physiological functions of LIS1 and NDEL1 in neurons have been ascribed for proteins fundamentally required for cell cycle progression and control.
20084519 Evidence of statistical epistasis between DISC1, CIT and NDEL1 impacting risk for schizophrenia: biological validation with functional neuroimaging.
20084519 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20048338 NDE1 and NDEL1 act upstream of LIS1 in dynein recruitment, and/or activation, on the membrane.
19927128 palmitoylated Ndel1 reduced cytoplasmic dynein activity as judged by Golgi distribution, VSVG and short microtubule trafficking, transport of endogenous Ndel1 and LIS1 from neurite tips to the cell body and neuronal migration
19632097 There was no strong evidence for association with NUDEL in schizophrenia.
19632097 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19622634 These results indicate an antagonistic effect of alpha1, alpha2 and Ndel1 for Lis1 binding, probably to modulate dynein functions in vivo.
19492042 These results suggest a novel mechanism for selective reinforcement of nascent adhesions via interplays of Nudel and FAK with paxillin to facilitate cell migration.
19251251 Observational study of gene-disease association. (HuGE Navigator)
19198602 Nudel regulates microtubule organization in part by facilitating assembly of the lamin B spindle matrix in a dynein-dependent manner.
18845247 NDEL1 protein interacts directly with Cyclic Nucleotide Phosphodiesterases, Type 4 and its isoforms and interaction of NDEL1 protein with phosphodiesterase isoform is uniquely disrupted by elevation of intracellular cyclic AMP levels.
18784752 Data show that LIS1 suppresses the motility of cytoplasmic dynein on microtubules, whereas NDEL1 releases the blocking effect of LIS1 on cytoplasmic dynein.
18469341 NDEL1 significantly influences risk for schizophrenia via an interaction with DISC1.
18469341 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18421979 NDEL1 regulates cytoplasmic dynein and involved in the regulation of microtubule organization, and becomes the target of various kinases and phosphatases.
18400883 For DISC1-related sporadic psychiatric disease, impaired cellular control over self-association of DISC1 leads to excessive multimerization and subsequent formation of detergent-resistant aggregates, with loss of ligand binding, exemplified by NDEL1.
18347064 Our work uncovers a unique regulatory mechanism of MT organization by PP4c through its targets Cdk1 and NDEL1 via regulation of katanin p60 distribution.
17997972 crystallographic study of two fragments of the coiled-coil domain of Ndel1, one of which reveals contiguous high-quality electron density for residues 10-166, the longest such structure reported by X-ray diffraction at high resolution
17600710 Ndel1-deficient cells enter anaphase in a timely manner but lagging chromosomes then manifest.
17494871 These results suggest a dual role of kinetochore Nudel: it activates dynein-mediated protein transport and, when interacting with both mitosin and dynein, stabilizes kinetochore dynein/dynactin.
17060449 Aurora-A-mediated phosphorylation of NDEL1 is essential for centrosomal separation and centrosomal maturation and for mitotic entry
16203747 NDEL1 is essential for mitotic cell division and neuronal migration not only via regulation of cytoplasmic dynein function but also by modulation of katanin p60 localization and function.
15728732 DISC1 inhibits NUDEL-oligopeptidase activity in a competitive fashion.
12556484 results point to the importance of Nudel-Lis1 interaction for the dynein activity in M phase and to a possible role of Nudel phosphorylation as facilitating such interaction.
12506198 disease mutant form of Disrupted-in-Schizophrenia-1 fails to bind NUDEL

AA Sequence

MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQ      1 - 70
RLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFE     71 - 140
QRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRERQQEVTRKSAPSSPTLDCEKMDSAV    141 - 210
QASLSLPATPVGKGTENTFPSPKAIPNGFGTSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQ    211 - 280
ASRKSYISGNVNCGVLNGNGTKFSRSGHTSFFDKGAVNGFDPAPPPPGLGSSRPSSAPGMLPLSV         281 - 345
//

Text Mined References (70)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26476704 2015 Increased expression of NDEL1 and MBP genes in the peripheral blood of antipsychotic-naïve patients with first-episode psychosis.
25416956 2014 A proteome-scale map of the human interactome network.
24785679 2014 The expression and roles of Nde1 and Ndel1 in the adult mammalian central nervous system.
23388542 2013 Plasma Ndel1 enzyme activity is reduced in patients with schizophrenia--a potential biomarker?
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22843697 2012 The mitosis and neurodevelopment proteins NDE1 and NDEL1 form dimers, tetramers, and polymers with a folded back structure in solution.
22832604 2011 Interactions of human truncated DISC1 proteins: implications for schizophrenia.
22453242 2012 Nudel is crucial for the WAVE complex assembly in vivo by selectively promoting subcomplex stability and formation through direct interactions.
22430153 2012 Misfolded G? is recruited to cytoplasmic dynein by Nudel for efficient clearance.
22373868 2012 Multiple modes of cytoplasmic dynein regulation.
21998303 2011 Molecular characterization of disrupted in schizophrenia-1 risk variant S704C reveals the formation of altered oligomeric assembly.
21948775 2011 Ndel1, Nudel (Noodle): flexible in the cell?
21283621 2011 The cytoskeletal protein Ndel1 regulates dynamin 2 GTPase activity.
21092859 2010 Genetic mosaic dissection of Lis1 and Ndel1 in neuronal migration.
21036906 2011 Functional dissection of LIS1 and NDEL1 towards understanding the molecular mechanisms of cytoplasmic dynein regulation.
20462516 2010 Assessing the role of endooligopeptidase activity of Ndel1 (nuclear-distribution gene E homolog like-1) in neurite outgrowth.
20168084 The essential role of LIS1, NDEL1 and Aurora-A in polarity formation and microtubule organization during neurogensis.
20084519 2010 Evidence of statistical epistasis between DISC1, CIT and NDEL1 impacting risk for schizophrenia: biological validation with functional neuroimaging.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20048338 2010 Functional interplay between LIS1, NDE1 and NDEL1 in dynein-dependent organelle positioning.
19927128 2010 Ndel1 palmitoylation: a new mean to regulate cytoplasmic dynein activity.
19632097 2009 Genetic association and post-mortem brain mRNA analysis of DISC1 and related genes in schizophrenia.
19622634 2009 Opposing effects of Ndel1 and alpha1 or alpha2 on cytoplasmic dynein through competitive binding to Lis1.
19492042 2009 Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19251251 2009 Association between genes of Disrupted in schizophrenia 1 (DISC1) interactors and schizophrenia supports the role of the DISC1 pathway in the etiology of major mental illnesses.
19198602 2009 Requirement for Nudel and dynein for assembly of the lamin B spindle matrix.
18845247 2008 Ndel1 alters its conformation by sequestering cAMP-specific phosphodiesterase-4D3 (PDE4D3) in a manner that is dynamically regulated through Protein Kinase A (PKA).
18784752 2008 LIS1 and NDEL1 coordinate the plus-end-directed transport of cytoplasmic dynein.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18469341 2008 Elucidating the relationship between DISC1, NDEL1 and NDE1 and the risk for schizophrenia: evidence of epistasis and competitive binding.
18421979 2008 [Molecular mechanism of lissencephaly--how LIS1 and NDEL1 regulate cytoplasmic dynein?].
18400883 2008 Insolubility of disrupted-in-schizophrenia 1 disrupts oligomer-dependent interactions with nuclear distribution element 1 and is associated with sporadic mental disease.
18347064 2008 Protein phosphatase 4 catalytic subunit regulates Cdk1 activity and microtubule organization via NDEL1 dephosphorylation.
17997972 2007 The structure of the coiled-coil domain of Ndel1 and the basis of its interaction with Lis1, the causal protein of Miller-Dieker lissencephaly.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17600710 2007 Cenp-F links kinetochores to Ndel1/Nde1/Lis1/dynein microtubule motor complexes.
17494871 2007 Nudel modulates kinetochore association and function of cytoplasmic dynein in M phase.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17060449 2007 NDEL1 phosphorylation by Aurora-A kinase is essential for centrosomal maturation, separation, and TACC3 recruitment.
17043677 2007 Disrupted in Schizophrenia 1 Interactome: evidence for the close connectivity of risk genes and a potential synaptic basis for schizophrenia.
17035248 2006 DISC1-NDEL1/NUDEL protein interaction, an essential component for neurite outgrowth, is modulated by genetic variations of DISC1.
16682949 2006 Centrosomal proteins Nde1 and Su48 form a complex regulated by phosphorylation.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16291865 2006 Nudel contributes to microtubule anchoring at the mother centriole and is involved in both dynein-dependent and -independent centrosomal protein assembly.
16203747 2005 Recruitment of katanin p60 by phosphorylated NDEL1, an LIS1 interacting protein, is essential for mitotic cell division and neuronal migration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16005531 2005 Cloning and characterization of the human and rabbit NUDEL-oligopeptidase promoters and their negative regulation.
15728732 2005 Inhibition of NUDEL (nuclear distribution element-like)-oligopeptidase activity by disrupted-in-schizophrenia 1.
15572112 2004 Coupling PAF signaling to dynein regulation: structure of LIS1 in complex with PAF-acetylhydrolase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14970193 2004 Nudel functions in membrane traffic mainly through association with Lis1 and cytoplasmic dynein.
14962739 2004 Disrupted in Schizophrenia 1 and Nudel form a neurodevelopmentally regulated protein complex: implications for schizophrenia and other major neurological disorders.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12812986 2003 DISC1 (Disrupted-In-Schizophrenia 1) is a centrosome-associated protein that interacts with MAP1A, MIPT3, ATF4/5 and NUDEL: regulation and loss of interaction with mutation.
12796778 2003 14-3-3epsilon is important for neuronal migration by binding to NUDEL: a molecular explanation for Miller-Dieker syndrome.
12621583 2003 Refinement of a 400-kb critical region allows genotypic differentiation between isolated lissencephaly, Miller-Dieker syndrome, and other phenotypes secondary to deletions of 17p13.3.
12556484 2003 Human Nudel and NudE as regulators of cytoplasmic dynein in poleward protein transport along the mitotic spindle.
12506198 2003 Disrupted-in-Schizophrenia-1 (DISC-1): mutant truncation prevents binding to NudE-like (NUDEL) and inhibits neurite outgrowth.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11163260 2000 NUDEL is a novel Cdk5 substrate that associates with LIS1 and cytoplasmic dynein.
11163259 2000 A LIS1/NUDEL/cytoplasmic dynein heavy chain complex in the developing and adult nervous system.
11163258 2000 LIS1 regulates CNS lamination by interacting with mNudE, a central component of the centrosome.
10931877 2000 The LIS1-related NUDF protein of Aspergillus nidulans interacts with the coiled-coil domain of the NUDE/RO11 protein.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.