Property Summary

NCBI Gene PubMed Count 42
PubMed Score 90.52
PubTator Score 46.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

 GO Function (1)

Gene RIF (25)

PMID Text
26350705 Interaction between NDE1 and high birth weight was associated with increased susceptibility to schizophrenia.
26206584 These data show that cell cycle-dependent mechanisms can control ciliary length through a CDK5-FBW7-NDE1 pathway.
25332407 study strengthens the evidence for association between rare variants within NDE1 and schizophrenia, and may shed light into the molecular mechanisms underlying this severe psychiatric disorder.
24785679 study provided comprehensive documentation of the expression patterns of Nde1 and Ndel1 in cultured cells as well as in mouse and human brains, and also highlighting that dosage effects of these two proteins might contribute to some cases of mental disorder
23704059 Description of a severe microcephaly syndrome where an autosomal recessive condition combines an inherited segmental duplication mediated deletion with a mutation in the NDE1 gene within the non-deleted homolog.
22843697 analysis of mixed NDE1-NDEL1 complexes demonstrates that NDE1 and NDEL1 can interact directly.
22526350 In three related patients with microhydranencephaly, a homozygous deletion that encompasses NDE1 exon 2 containing the initiation codon was identified.
21911489 Mutually exclusive cytoplasmic dynein regulation by NudE-Lis1 and dynactin.
21529752 NDE1 deficiency causes both a severe failure of neurogenesis and a deficiency in cortical lamination
21529751 NDE1 mutations cause a severe microlissencephaly syndrome. Patient's NDE1 proteins are unstable, cannot bind cytoplasmic dynein, and do not localize properly to the centrosome.
20084519 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20072148 The NDE1 gene is disrupted by the inv(16) in 90% of cases with CBFB-MYH11-positive acute myeloid leukemia.
20048338 NDE1 and NDEL1 act upstream of LIS1 in dynein recruitment, and/or activation, on the membrane.
18983980 NDE1, NDEL1 and LIS1, together with their binding partner dynein, associate with DISC1, PDE4B and PDE4D within the cell, and provide evidence that this complex is present at the centrosome.
18469341 NO direct relationship between NDE1 genotype and schizophrenia.
18469341 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18303022 These findings reveal a novel regulatory mechanism of vimentin transport during neurite extension that may have implications in diseases featuring transport/trafficking defects and impaired regeneration.
18178387 We failed to find the association between the NDE1 gene and schizophrenia in the Japanese population.
18178387 Observational study of gene-disease association. (HuGE Navigator)
17600710 required for kinetochore localization of dynein; suppression of Nde1 inhibits metaphase chromosome alignment and activates the spindle checkpoint
17185386 Two additional loci displayed an evidence of linkage (LOD > 3) and included a locus on 16p13, proximal to the gene encoding NDE1, which has been shown to biologically interact with DISC1.
16682949 findings indicate that Nde1 can form a protein complex with Su48 in the centrosome and plays an important role for successful mitosis
15797709 Nudel is seen to differentially associate with mitochondrial markers in comparison to DISC1. Disruption of the cytoskeleton results in colocalization of Nudel and mitochondrial markers--the first observation of such a direct relationship.
12556484 study of the properties of NudE in mitosis; comparative studies suggest that NudE is functionally related to its paralog, Nudel
12427674 LIS1 deficiency adversely affects the migration and differentiation of DCX- and Reelin-positive neurons.

AA Sequence

MEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNR      1 - 70
LRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQ     71 - 140
RLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQKQEKPRTPMPSSVEAERTDTAVQATG    141 - 210
SVPSTPIAHRGPSSSLNTPGSFRRGLDDSTGGTPLTPAARISALNIVGDLLRKVGALESKLASCRNLVYD    211 - 280
QSPNRTGGPASGRSSKNRDGGERRPSSTSVPLGDKGLGKRLEFGKPPSHMSSSPLPSAQGVVKMLL        281 - 346
//

Text Mined References (48)

PMID Year Title
26350705 2015 An interaction between NDE1 and high birth weight increases schizophrenia susceptibility.
26206584 2015 Cell cycle-dependent ubiquitylation and destruction of NDE1 by CDK5-FBW7 regulates ciliary length.
25332407 2015 Identification of Rare, Single-Nucleotide Mutations in NDE1 and Their Contributions to Schizophrenia Susceptibility.
24785679 2014 The expression and roles of Nde1 and Ndel1 in the adult mammalian central nervous system.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23704059 2013 Deletion 16p13.11 uncovers NDE1 mutations on the non-deleted homolog and extends the spectrum of severe microcephaly to include fetal brain disruption.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22843697 2012 The mitosis and neurodevelopment proteins NDE1 and NDEL1 form dimers, tetramers, and polymers with a folded back structure in solution.
22526350 2012 Novel NDE1 homozygous mutation resulting in microhydranencephaly and not microlyssencephaly.
21911489 2011 Mutually exclusive cytoplasmic dynein regulation by NudE-Lis1 and dynactin.
21529752 2011 The essential role of centrosomal NDE1 in human cerebral cortex neurogenesis.
21529751 2011 Human mutations in NDE1 cause extreme microcephaly with lissencephaly [corrected].
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20084519 2010 Evidence of statistical epistasis between DISC1, CIT and NDEL1 impacting risk for schizophrenia: biological validation with functional neuroimaging.
20072148 2010 The NDE1 gene is disrupted by the inv(16) in 90% of cases with CBFB-MYH11-positive acute myeloid leukemia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20048338 2010 Functional interplay between LIS1, NDE1 and NDEL1 in dynein-dependent organelle positioning.
19946888 2010 Defining the membrane proteome of NK cells.
19927128 2010 Ndel1 palmitoylation: a new mean to regulate cytoplasmic dynein activity.
19468067 2009 Mitotic control of kinetochore-associated dynein and spindle orientation by human Spindly.
19000741 2009 NDE1 and NDEL1: multimerisation, alternate splicing and DISC1 interaction.
18983980 2008 DISC1, PDE4B, and NDE1 at the centrosome and synapse.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18469343 2008 Lis1-Nde1-dependent neuronal fate control determines cerebral cortical size and lamination.
18469341 2008 Elucidating the relationship between DISC1, NDEL1 and NDE1 and the risk for schizophrenia: evidence of epistasis and competitive binding.
18303022 2008 Ndel1 controls the dynein-mediated transport of vimentin during neurite outgrowth.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18178387 2008 No association between the NDE1 gene and schizophrenia in the Japanese population.
17997972 2007 The structure of the coiled-coil domain of Ndel1 and the basis of its interaction with Lis1, the causal protein of Miller-Dieker lissencephaly.
17600710 2007 Cenp-F links kinetochores to Ndel1/Nde1/Lis1/dynein microtubule motor complexes.
17185386 2007 Families with the risk allele of DISC1 reveal a link between schizophrenia and another component of the same molecular pathway, NDE1.
16682949 2006 Centrosomal proteins Nde1 and Su48 form a complex regulated by phosphorylation.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16291865 2006 Nudel contributes to microtubule anchoring at the mother centriole and is involved in both dynein-dependent and -independent centrosomal protein assembly.
15797709 2005 Subcellular targeting of DISC1 is dependent on a domain independent from the Nudel binding site.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12556484 2003 Human Nudel and NudE as regulators of cytoplasmic dynein in poleward protein transport along the mitotic spindle.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12427674 2002 Selective expression of doublecortin and LIS1 in developing human cortex suggests unique modes of neuronal movement.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.