Property Summary

NCBI Gene PubMed Count 77
PubMed Score 253.32
PubTator Score 201.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
malignant mesothelioma 2.000 5.1e-08
psoriasis 2.000 1.1e-14
astrocytoma 1.100 1.3e-05
glioblastoma 3.800 1.1e-11
oligodendroglioma 1.300 9.7e-05
posterior fossa group A ependymoma 2.900 9.0e-09
group 3 medulloblastoma 4.900 8.1e-09
atypical teratoid/rhabdoid tumor 3.700 2.7e-13
medulloblastoma, large-cell 3.900 2.3e-07
primitive neuroectodermal tumor 4.400 3.3e-07
Atopic dermatitis 2.400 1.2e-05
adrenocortical carcinoma 2.297 2.0e-04
non-small cell lung cancer 2.911 1.5e-29
intraductal papillary-mucinous carcinoma... 3.100 4.4e-04
intraductal papillary-mucinous neoplasm ... 3.900 1.4e-03
colon cancer 1.500 4.8e-02
lung cancer 3.800 4.6e-05
pancreatic cancer 1.500 1.2e-04
breast carcinoma 1.500 6.0e-04
Breast cancer 3.200 4.5e-19
interstitial cystitis 1.400 1.3e-02
lung adenocarcinoma 1.900 8.8e-07
pediatric high grade glioma 3.700 2.9e-08
pilocytic astrocytoma 1.500 2.0e-04
primary Sjogren syndrome 1.600 1.7e-03
nasopharyngeal carcinoma 1.900 2.0e-05
Endometriosis 2.161 1.0e-02
ductal carcinoma in situ 2.100 7.6e-03
invasive ductal carcinoma 2.400 4.7e-04
ulcerative colitis 1.300 1.4e-03
ovarian cancer 2.500 7.5e-05

Gene RIF (43)

PMID Text
26612002 we conclude that Hec1 is consistently overexpressed in human PCa and Hec1 is closely linked with human PCa progression through the meditator LncRNA BX647187
25808492 Independent molecular binding events to microtubules (MTs) by individual NDC80 complexes, rather than their structured oligomers, regulate the dynamics and stability of kinetochore-MT attachments in dividing cells.
25601404 Mechanisms of mitosis-specific assembly of the checkpoint platform Knl1/MIS12/NDC80 at human kinetochores.
25557589 Overproduction of Ndc80 in cancer cells may unfavourably absorb protein interactors through the internal loop domain and lead to a change in the equilibrium of microtubule-associated proteins. [Review]
25132262 N-terminus-modified Hec1 suppresses tumour growth by interfering with kinetochore-microtubule dynamics
24694948 Certain clinical subtypes of breast cancer more likely to respond to Hec1-targeted therapy were identified and these subtypes are the ones associated with poor prognosis.
24413531 The Ndc80 complex binds straight microtubules by recognizing the dimeric interface of tubulin.
24327015 Growth inhibition following knockdown of NDC80, CDK1 and PLK1.
24187132 a novel role for Aurora B-Hec1-Mps1 signaling axis in governing accurate chromosome segregation in mitosis
24129578 these findings demonstrated that three buried glutamic acid-lysine pairs, in concert with hydrophobic interactions of core residues, provide the major specificity and stability requirements for Hec1-Nuf2 dimerization
23591767 Hec1 is critical in maintaining the in vitro and in vivo growth of gastric cancer cells; elevated Hec1 levels may occur at the early stage of gastric tumorigenesis
23474708 Hec1 expression was highest in paclitaxel-resistant A2780/Taxol cells.
23085714 Ndc80's interaction with either growing or shrinking microtubule ends can be tuned by the phosphorylation state of its tail.
23056589 NDC80, NUF2 and PTN were significantly aberrantly overexpressed in serous adenocarcinomas.
22908300 The Ndc80 kinetochore complex directly modulates microtubule dynamics.
22581055 results support the conclusion that Cdt1 binding to Hec1 is essential for an extended Ndc80 configuration and stable kinetochore-microtubule attachment
22561346 results reveal the molecular function of CENP-T proteins and demonstrate how the Ndc80 complex is anchored to centromeres in a manner that couples chromosome movement to spindle dynamics
22454517 The Ndc80 internal loop is essential for end-on microtubule attachment to kinetochores.
21832156 Hec1 serine 165 (S165) is preferentially phosphorylated at kinetochores by Nek2 and it serves as an important mechanism in modulating spindle assemble checkpoint signaling and chromosome alignment.
21352579 Alteration in NDC80, were also detected in benign breast tumors.
21325630 In vertebrates there is a tripartite attachment point facilitating the interaction between Hec1/Ndc80 and microtubules.
21297979 N-terminally modified Hec1 promotes spindle pole fragmentation by CENP-E-mediated plus-end directed kinetochore pulling forces that disrupt the fine balance of kinetochore- and centrosome-associated forces regulating spindle bipolarity
21270439 These data suggest that the CH and tail domains of Hec1 generate essential contacts between kinetochores and microtubules in cells, whereas the Nuf2 CH domain does not.
21266467 Hec1 phosphorylation control kinetochore-microtubule attachment stability during mitosis.
21056971 CENP-U is a novel microtubule binding protein and plays an important role in kinetochore-microtubule attachment through its interaction with Hec1
20948316 Data provide evidence for a functional link between Hec1 expression and the pRb pathway.
20944740 subnanometre-resolution cryo-electron microscopy reconstruction of the human Ndc80 complex bound to microtubules
20508983 Observational study of gene-disease association. (HuGE Navigator)
19878654 cell growths of colorectal and gastric cancers after the siRNA-mediated knockdown of either CDCA1 or KNTC2 were significantly suppressed.
19776357 Results suggest that Hec1, through cooperation with Hice1, contributes to centrosome-directed microtubule growth to facilitate establishing a proper mitotic spindle.
19553660 Data show that the kinetochore localization of PinX1 is dependent on Hec1 and CENP-E.
18794333 Results suggest that the globular domain of the Ndc80 subunit binds strongly at the interface between tubulin dimers and weakly at the adjacent intradimer interface along the microtubule protofilament axis.
18782526 Hec 1 was highhy expressed in cancer tissues with lymph node metastasis and poor differentiation.
18455984 The 180 kDa Ndc80 complex is a direct point of contact between kinetochores and microtubules; its four subunits contain coiled coils and form an elongated rod structure with functional globular domains at either end.
18297113 that Hec1 binds to microtubule in low affinity and phosphorylation by NEK2A, which prevents aberrant kinetochore-microtubule connections in vivo, increases the affinity of the Ndc80 complex for microtubules in vitro
17822787 overexpression of either CREB or ATF4 enhanced the activation of the HEC1 promoter and overexpression of both of them had an additive effect on the activation of the HEC1 transcription.
17195848 Study describes the crystal structure of the most conserved region of HEC1, which lies at one end of the rod and near the N terminus of the polypeptide chain, it folds into a calponin-homology domain.
17129782 These findings reveal a key role for the Hec1 N terminus in controlling dynamic behavior of kinetochore microtubules.
15961401 the Spc24, Spc25, Nuf2, and Ndc80/Hec1 complex is a faithful copy of the endogenous Ndc80 complex
15931389 Altered expression is associated with therapy failure and death in patients with multiple types of cancer.
15548592 HEC1 is a core component of the kinetochore outer plate essential for organizing microtubule attachment sites.
12386167 cell cycle-regulated serine phosphorylation of Hec1 by Nek2 is essential for faithful chromosome segregation
12351790 role in spindle checkpoint signaling; required for the recruitment of Mps1 kinase and Mad1/Mad2 complexes to kinetochores

AA Sequence

MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTSERKVSLFGKRTSGHGSRNSQ      1 - 70
LGIFSSSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAPSVKDFLKIFTFLYGFLCPSY     71 - 140
ELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPHIVAALVWLIDCIKIHTAMKESSPLFDDGQP    141 - 210
WGEETEDGIMHNKLFLDYTIKCYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIA    211 - 280
RLEQEREKEPNRLESLRKLKASLQGDVQKYQAYMSNLESHSAILDQKLNGLNEEIARVELECETIKQENT    281 - 350
RLQNIIDNQKYSVADIERINHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLAR    351 - 420
KLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELLNETEEEINKALNKKMGLEDTLEQLN    421 - 490
AMITESKRSVRTLKEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKHLLESTVNQGLSEAMNELDAV    491 - 560
QREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKY    561 - 630
EKKATLIKSSEE                                                              631 - 642
//

Text Mined References (82)

PMID Year Title
27156448 2016 A TOG Protein Confers Tension Sensitivity to Kinetochore-Microtubule Attachments.
26612002 2015 The mitotic regulator Hec1 is a critical modulator of prostate cancer through the long non-coding RNA BX647187 in vitro.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25808492 2015 Multisite phosphorylation of the NDC80 complex gradually tunes its microtubule-binding affinity.
25743205 2015 Chromokinesin Kid and kinetochore kinesin CENP-E differentially support chromosome congression without end-on attachment to microtubules.
25601404 2015 Multiple assembly mechanisms anchor the KMN spindle checkpoint platform at human mitotic kinetochores.
25557589 2015 MAPping the Ndc80 loop in cancer: A possible link between Ndc80/Hec1 overproduction and cancer formation.
25416956 2014 A proteome-scale map of the human interactome network.
25132262 2015 N-terminus-modified Hec1 suppresses tumour growth by interfering with kinetochore-microtubule dynamics.
24694948 2014 Activity of a novel Hec1-targeted anticancer compound against breast cancer cell lines in vitro and in vivo.
24413531 2014 Structural basis for microtubule recognition by the human kinetochore Ska complex.
24327015 2014 An RNAi-based screen reveals PLK1, CDK1 and NDC80 as potential therapeutic targets in malignant pleural mesothelioma.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24187132 2013 Phosphorylation of microtubule-binding protein Hec1 by mitotic kinase Aurora B specifies spindle checkpoint kinase Mps1 signaling at the kinetochore.
24129578 2013 Complementary interhelical interactions between three buried Glu-Lys pairs within three heptad repeats are essential for Hec1-Nuf2 heterodimerization and mitotic progression.
23891108 2013 Lateral to end-on conversion of chromosome-microtubule attachment requires kinesins CENP-E and MCAK.
23591767 2014 Hec1/Ndc80 is overexpressed in human gastric cancer and regulates cell growth.
23474708 2013 Inhibition of Hec1 expression enhances the sensitivity of human ovarian cancer cells to paclitaxel.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085714 2012 Multimodal microtubule binding by the Ndc80 kinetochore complex.
23085020 2012 The kinetochore-bound Ska1 complex tracks depolymerizing microtubules and binds to curved protofilaments.
23056589 2012 An RNA interference lethality screen of the human druggable genome to identify molecular vulnerabilities in epithelial ovarian cancer.
22908300 2012 The Ndc80 kinetochore complex directly modulates microtubule dynamics.
22581055 2012 Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment.
22561346 2012 CENP-T proteins are conserved centromere receptors of the Ndc80 complex.
22454517 2012 The Ndc80 internal loop is required for recruitment of the Ska complex to establish end-on microtubule attachment to kinetochores.
21832156 2011 Phosphorylation of the Ndc80 complex protein, HEC1, by Nek2 kinase modulates chromosome alignment and signaling of the spindle assembly checkpoint.
21352579 2011 Expression analysis of mitotic spindle checkpoint genes in breast carcinoma: role of NDC80/HEC1 in early breast tumorigenicity, and a two-gene signature for aneuploidy.
21325630 2011 The Ndc80 complex uses a tripartite attachment point to couple microtubule depolymerization to chromosome movement.
21297979 2011 Abnormal kinetochore-generated pulling forces from expressing a N-terminally modified Hec1.
21270439 2011 The NDC80 complex proteins Nuf2 and Hec1 make distinct contributions to kinetochore-microtubule attachment in mitosis.
21269460 2011 Initial characterization of the human central proteome.
21266467 2011 Temporal changes in Hec1 phosphorylation control kinetochore-microtubule attachment stability during mitosis.
21056971 2011 CENP-U cooperates with Hec1 to orchestrate kinetochore-microtubule attachment.
20948316 2010 Expression of the kinetochore protein Hec1 during the cell cycle in normal and cancer cells and its regulation by the pRb pathway.
20944740 2010 The Ndc80 kinetochore complex forms oligomeric arrays along microtubules.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19878654 2009 siRNA-mediated knockdown against CDCA1 and KNTC2, both frequently overexpressed in colorectal and gastric cancers, suppresses cell proliferation and induces apoptosis.
19776357 2009 Hec1 contributes to mitotic centrosomal microtubule growth for proper spindle assembly through interaction with Hice1.
19553660 2009 PinX1 is a novel microtubule-binding protein essential for accurate chromosome segregation.
19468067 2009 Mitotic control of kinetochore-associated dynein and spindle orientation by human Spindly.
18794333 2008 Orientation and structure of the Ndc80 complex on the microtubule lattice.
18782526 2008 [Expression and clinical significance of highly expressed protein in cancer (Hec 1) in human primary gallbladder carcinoma].
18455984 2008 Implications for kinetochore-microtubule attachment from the structure of an engineered Ndc80 complex.
18297113 2008 The mitotic checkpoint kinase NEK2A regulates kinetochore microtubule attachment stability.
18195732 2008 Cyclin B1 is localized to unattached kinetochores and contributes to efficient microtubule attachment and proper chromosome alignment during mitosis.
17822787 Functional characterization of the promoter of human kinetochore protein HEC1: novel link between regulation of the cell cycle protein and CREB family transcription factors.
17363900 2007 The human Nup107-160 nuclear pore subcomplex contributes to proper kinetochore functions.
17195848 2007 The Ndc80/HEC1 complex is a contact point for kinetochore-microtubule attachment.
17129783 2006 The conserved KMN network constitutes the core microtubule-binding site of the kinetochore.
17129782 2006 Kinetochore microtubule dynamics and attachment stability are regulated by Hec1.
16732327 2006 Hec1 sequentially recruits Zwint-1 and ZW10 to kinetochores for faithful chromosome segregation and spindle checkpoint control.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15964272 2005 Polo-like kinase 1 creates the tension-sensing 3F3/2 phosphoepitope and modulates the association of spindle-checkpoint proteins at kinetochores.
15961401 2005 Architecture of the human ndc80-hec1 complex, a critical constituent of the outer kinetochore.
15931389 2005 Microarray analysis identifies a death-from-cancer signature predicting therapy failure in patients with multiple types of cancer.
15824131 2005 ZW10 links mitotic checkpoint signaling to the structural kinetochore.
15713649 2005 The functional region of CENP-H interacts with the Nuf2 complex that localizes to centromere during mitosis.
15548592 2005 Hec1 and nuf2 are core components of the kinetochore outer plate essential for organizing microtubule attachment sites.
15504738 2005 Genes affecting the cell cycle, growth, maintenance, and drug sensitivity are preferentially regulated by anti-HER2 antibody through phosphatidylinositol 3-kinase-AKT signaling.
15502821 2004 A conserved Mis12 centromere complex is linked to heterochromatic HP1 and outer kinetochore protein Zwint-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15239953 2004 Timing and checkpoints in the regulation of mitotic progression.
15235793 2004 Kinetochore localization and microtubule interaction of the human spindle checkpoint kinase Mps1.
15133482 2004 Sgt1 is required for human kinetochore assembly.
15062103 2004 The RanGAP1-RanBP2 complex is essential for microtubule-kinetochore interactions in vivo.
14978040 2004 NEK2A interacts with MAD1 and possibly functions as a novel integrator of the spindle checkpoint signaling.
14699129 2004 Identification of two novel components of the human NDC80 kinetochore complex.
14654001 2003 Nuf2 and Hec1 are required for retention of the checkpoint proteins Mad1 and Mad2 to kinetochores.
14602875 2004 Identification of the substrates and interaction proteins of aurora kinases from a protein-protein interaction model.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12386167 2002 Phosphorylation of the mitotic regulator protein Hec1 by Nek2 kinase is essential for faithful chromosome segregation.
12351790 2002 Role of Hec1 in spindle checkpoint signaling and kinetochore recruitment of Mad1/Mad2.
10779342 2000 Retinoblastoma protein enhances the fidelity of chromosome segregation mediated by hsHec1p.
10409732 1999 Hec1p, an evolutionarily conserved coiled-coil protein, modulates chromosome segregation through interaction with SMC proteins.
9315664 1997 HEC, a novel nuclear protein rich in leucine heptad repeats specifically involved in mitosis.
9295362 1997 HEC binds to the seventh regulatory subunit of the 26 S proteasome and modulates the proteolysis of mitotic cyclins.
8384581 1993 The retinoblastoma protein associates with the protein phosphatase type 1 catalytic subunit.