Property Summary

NCBI Gene PubMed Count 121
PubMed Score 133.24
PubTator Score 114.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.800 1.1e-03
Astrocytoma, Pilocytic 1.100 4.6e-06
atypical teratoid / rhabdoid tumor 1.500 2.1e-07
ependymoma 1.500 2.8e-03
glioblastoma 1.300 2.8e-06
medulloblastoma, large-cell 1.200 2.2e-03
oligodendroglioma 1.300 1.2e-03
osteosarcoma 1.129 2.1e-05
pediatric high grade glioma 1.100 2.2e-06
primitive neuroectodermal tumor 1.100 4.2e-04

 GO Function (1)

Gene RIF (90)

AA Sequence

MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDT      1 - 70
GVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQC     71 - 140
PNDGFGVYSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTF    141 - 210
PLCAMQLFSHMHAVISTATCMRRSSIQSTFSINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAAT    211 - 280
RLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKG    281 - 350
KFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQ    351 - 420
PLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFVTDTAKALADV    421 - 490
ATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSP    491 - 560
TNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRCVRSTARLARA    561 - 630
LSPAFELSQWSSTEYSTWTESRWKDIRARIFLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIA    631 - 700
PREPGAVSY                                                                 701 - 709
//

Text Mined References (130)

PMID Year Title