Property Summary

NCBI Gene PubMed Count 17
PubMed Score 20.84
PubTator Score 6.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
26582946 NKp30-B7-H6 interaction is a novel cell contact mechanism that mediates activation of Group 2 innate lymphoid cells and identifies a potential target for the development of novel therapeutics for atopic dermatitis and other atopic diseases.
26472927 study not only reveals the possibility that tumor therapeutics work as stress inducers to enhance tumor sensitivity to NK cell cytolysis but also suggests that B7-H6 could be a potential target for tumor therapy in the future
26464699 our present data revealed that higher B7-H6 expression in ovarian cancer tissues was positively correlated with tumor metastasis and cancer progression
26241657 Our results suggest that NKP30-B7-H6 interaction can aggravate hepatocyte damage, probably through up-regulation of IL-32 expression in hepatitis B virus-related acute-on-chronic liver failure
25877893 the interaction between NKp30 and B7-H6 may contribute to the fate of neuroblastoma patients
25400778 Study suggests that B7-H6 has a limited value as a prognostic marker in non-small cell lung cancer patients.
25001651 Allogeneic and xenogeneic anti-tumor effect of callithrix jacchus natural killer cells is dependent on NKp30 and B7-H6 interaction.
24780758 this study identified ectodomain shedding of B7-H6 by the metalloproteases "a disintegrin and metalloproteases" (ADAM)-10 and ADAM-17 from the cell surface of tumor cells as a crucial mechanism of expression regulation of B7-H6.
24275655 Data indicate that the ectodomain of NKp30 forms functional homo-oligomers that mediate high affinity binding to its corresponding cellular ligand B7-H6.
24242703 B7-H6-positive carcinomas were significantly associated with a higher differentiation.
23687088 These findings reveal that B7-H6 is not only implicated in tumor immunosurveillance but also participates in the inflammatory response in infectious conditions.
23066150 B7-H6:7D8 represents the first Ab-based molecule stimulating NKp30-mediated NK cell cytotoxicity for therapeutic purposes
21422170 The NKp30-B7-H6 structure revealed that this NK cell activating complex is distinct from the CTLA4-B7 and PD-1-PD-L T cell inhibitory complexes in both overall organization and detailed atomic interactions that mediate binding and specificity.
19528259 DKFZp686O24166 was designated the gene B7-H6; identification as a tumor cell surface molecule that binds NKp30, a receptor which triggers antitumor NK cell cytotoxicity and cytokine secretion
18187620 Knockdown of B7 homolog 6 (B7H6; DKFZp686O24166) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MTWRAAASTCAALLILLWALTTEGDLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSL      1 - 70
TFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVV     71 - 140
ASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVT    141 - 210
SCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSIHWWPISFIGVGLVLLIV    211 - 280
LIPWKKICNKSSSAYTPLKCILKHWNSFDTQTLKKEHLIFFCTRAWPSYQLQDGEAWPPEGSVNINTIQQ    281 - 350
LDVFCRQEGKWSEVPYVQAFFALRDNPDLCQCCRIDPALLTVTSGKSIDDNSTKSEKQTPREHSDAVPDA    351 - 420
PILPVSPIWEPPPATTSTTPVLSSQPPTLLLPLQ                                        421 - 454
//

Text Mined References (20)

PMID Year Title
26582946 2016 Group 2 Innate Lymphoid Cells Express Functional NKp30 Receptor Inducing Type 2 Cytokine Production.
26472927 2015 Tumor Therapeutics Work as Stress Inducers to Enhance Tumor Sensitivity to Natural Killer (NK) Cell Cytolysis by Up-regulating NKp30 Ligand B7-H6.
26464699 2015 B7-H6 expression correlates with cancer progression and patient's survival in human ovarian cancer.
26241657 2015 NKP30-B7-H6 Interaction Aggravates Hepatocyte Damage through Up-Regulation of Interleukin-32 Expression in Hepatitis B Virus-Related Acute-On-Chronic Liver Failure.
25877893 2015 Clinical impact of the NKp30/B7-H6 axis in high-risk neuroblastoma patients.
25400778 2014 B7-H6 expression in non-small cell lung cancers.
25001651 Allogeneic and xenogeneic anti-tumor effect of callithrix jacchus natural killer cells is dependent on NKp30 and B7-H6 interaction.
24780758 2014 Metalloprotease-mediated tumor cell shedding of B7-H6, the ligand of the natural killer cell-activating receptor NKp30.
24275655 2014 Homo-oligomerization of the activating natural killer cell receptor NKp30 ectodomain increases its binding affinity for cellular ligands.
24242703 2014 B7-H6 protein expression has no prognostic significance in human gastric carcinoma.
23687088 2013 Induction of B7-H6, a ligand for the natural killer cell-activating receptor NKp30, in inflammatory conditions.
23066150 2012 Mimicking an induced self phenotype by coating lymphomas with the NKp30 ligand B7-H6 promotes NK cell cytotoxicity.
21877119 2011 B7-H6/NKp30 interaction: a mechanism of alerting NK cells against tumors.
21444796 2011 Crystal structure of human natural cytotoxicity receptor NKp30 and identification of its ligand binding site.
21422170 2011 Structure of the human activating natural cytotoxicity receptor NKp30 bound to its tumor cell ligand B7-H6.
19528259 2009 The B7 family member B7-H6 is a tumor cell ligand for the activating natural killer cell receptor NKp30 in humans.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.