Property Summary

NCBI Gene PubMed Count 75
PubMed Score 343.66
PubTator Score 178.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
tuberculosis 1.600 7.8e-06
interstitial cystitis 1.400 9.5e-03

Gene RIF (60)

PMID Text
26582946 NKp30-B7-H6 interaction is a novel cell contact mechanism that mediates activation of Group 2 innate lymphoid cells and identifies a potential target for the development of novel therapeutics for atopic dermatitis and other atopic diseases.
26241657 Our results suggest that NKP30-B7-H6 interaction can aggravate hepatocyte damage, probably through up-regulation of IL-32 expression in hepatitis B virus-related acute-on-chronic liver failure
26094914 Suggest role for NKp30 isoforms in influencing liver damage and ensuing fibrosis in chronic hepatitis C infection.
25991472 Age and CMV serostatus influence the expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated natural killer cells.
25877893 the interaction between NKp30 and B7-H6 may contribute to the fate of neuroblastoma patients
25824372 show that in addition to NKG2D, human CEACAM1 can inhibit NK-cell activation via NKp30 or 2B4
25315772 Tumor-released Galectin-3, a soluble inhibitory ligand of human NKp30, plays an important role in tumor escape from NK cell attack.
25001651 Allogeneic and xenogeneic anti-tumor effect of callithrix jacchus natural killer cells is dependent on NKp30 and B7-H6 interaction.
24882570 Up-regulation of DNAM-1 and NKp30, associated with improvement of NK cells activation after long-term culture of mononuclear cells from patients with ovarian neoplasms.
24275655 Data indicate that the ectodomain of NKp30 forms functional homo-oligomers that mediate high affinity binding to its corresponding cellular ligand B7-H6.
24162774 HIV-1 gp120 downregulates the expression of natural cytotoxicity triggering receptor 3 (NCR3) in human B cells
24139398 NKp30 was required for natural killer cell-fungal conjugate formation, phosphatidylinositol 3-kinase (PI3K) signaling, and perforin release.
24133212 we show for the first time that BAG-6(686-936) comprises a subdomain of BAG-6, which is sufficient for receptor docking and inhibition of NKp30-dependent NK cell cytotoxicity as part of a tumor immune escape mechanism
23884468 Findings suggest that NK cells may promote an NKp30-dependent inflammatory state in salivary glands and that blockade of the B7H6/NKp30 axis could be clinically relevant in primary Sjogren's syndrome.
23687088 These findings reveal that B7-H6 is not only implicated in tumor immunosurveillance but also participates in the inflammatory response in infectious conditions.
23490421 Cytokine stimulation combined with natural killer cell receptor engagement are required for human natural killer cell functional diversity.
23456936 HHIP, HDAC4, NCR3 and RARB polymorphisms may have a role in impaired lung function that begins in early life
23360454 data describe immune escape mechanism of monoclonal gammopathy/multiple myeloma occuring via downregulation of 3 major activating NK receptors (NCR3/NKp30, NKG2D and CD244/2B4/p38) in bone marrow, that was undetectable in peripheral blood.
23345327 Natural cytotoxicity receptors play a major role in the recognition by NK cells of cancer stem cells targets.
23066150 B7-H6:7D8 represents the first Ab-based molecule stimulating NKp30-mediated NK cell cytotoxicity for therapeutic purposes
23059620 Using a codon-optimized gene fragment, we report remarkable yields for extracellular domain of human NK cell receptor (NKp30ex) when produced on M9 minimal medium, even with low (2g/L) glucose concentration.
22851709 NKp30 chimeric antigen receptor-expressing T cells produce interferon (IFN)-gamma and kill B7-H6 ligand-expressing tumor cells in vivo.
22807449 The stalk domain and the glycosylation status of the activating natural killer cell receptor NKp30 are important for ligand binding.
22360401 NKp30 expression is significantly increased on the natural killer cells that persist at one week post-liver transplant in pediatric patients.
22221078 NKp30 is a triggering receptor downstream of adhesion and plays an important role in NK cell activation, degranulation and cytotoxicity.
22044312 a precise analysis of clinical data showed a correlation between decreased NCR expression and poor prognosis factors such as low haemoglobin level, high (>30x10(9) per litre) lymphocyte count or elevated C-reactive protein
21552268 alternatively spliced isoforms affect the prognosis of gastrointestinal stromal tumors
21444796 This study provides insights into NKp30 ligand recognition and a framework for a potential family of unidentified ligands.
21422170 The NKp30-B7-H6 structure revealed that this NK cell activating complex is distinct from the CTLA4-B7 and PD-1-PD-L T cell inhibitory complexes in both overall organization and detailed atomic interactions that mediate binding and specificity.
20812318 NKp30(high) cells are more effective in preventing infection of hepatitis C in high risk intravenous drug addicted individuals.
20712903 Observational study of gene-disease association. (HuGE Navigator)
20663564 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19580844 In the presence of DC-derived cytokines such as interleukin-12, in both patients & healthy individuals, DNAM-1 can cooperate with NKp30 to induce NK cells to kill DC, release tumor necrosis factor-alpha, & promote DC maturation.
19551844 Myeloid-derived suppressor cell-mediated inhibition of NK cell function was dependent mainly on the NKp30 on NK cells.
19528259 Results report the identification of B7-H6, a tumor cell surface molecule that binds NKp30, a human receptor which triggers antitumor NK cell cytotoxicity and cytokine secretion.
19143814 Observational study of gene-disease association. (HuGE Navigator)
18852879 NKp30-mediated NK cells/dendritic cells cross talk resulting either in iDC killing or maturation was BAT3-dependent
18802053 NKp30 is the only functional cytotoxicity receptor expressed on a small number of freshly isolated umbilical cord blood T cells, as demonstrated by degranulation, IFN-gamma release, redirected killing, and apoptosis.
18713971 differential, controlled role of NKp46- and NKp30-activating receptors expressed by uterine dNK that could be critical for the outcome of pregnancy
18275895 in NK cells cultured with IL-15, we observed an up-regulation of the activating receptors NKG2D, NKp30, and NKp46, associated with an increase in anti-tumor lytic activity.
18157817 transcription and translation of the novel form of NKp30 can be induced by progesterone treatment
18092004 Expression of NKp30 and NKp44 ligands was variable and did not correlate with the origin of the cell line. Expression of NKp30 and NKp44 ligand correlated with NKp30 and NKp44-mediated NK cell lysis of tumor cells, respectively
18055229 HLA-B-associated transcript 3 (BAT3) was released from tumor cells, bound directly to NKp30, and engaged NKp30 on NK cells. BAT3 triggered NKp30-mediated cytotoxicity and was necessary for tumor rejection in a multiple myeloma model.
18023431 Determined expressions of NKp30 in decidual natural killer cells in patients having spontaneous abortions.
17436233 Shown that NKp30-immunoglobulin recombinant fusion protein is Duffy binding-like proteins, natural cytotoxicity receptors are involved in naturual killer cell-Plasmodium- parasitized erythrocytes.
17208487 Observational study of gene-disease association. (HuGE Navigator)
17208487 evidence reported of an association between mild malaria and NCR3 -412G>C polymorphism located within the promoter
16690951 defect in cytotoxic effector function is associated with a reduced surface expression of activating NK receptors (NKp30, NKp46, and NKG2D) on CD56(dim) NK cells compared with uninfected newborns.
16362817 The expression of LST1, specifically splice variants encoding soluble isoforms and NCR3, was increased in rheumatoid-arthritis-affected blood and synovium and was associated with more severe inflammation in the synovium.
16272287 NKp30, among natural cytotoxicity receptors, appeared to be primarily involved in triggering NK cells upon interaction with bone marrow stromal cells
15972650 heparan sulfate glycosaminoglycans are not ligands for NKp30, leaving open the question as to the nature of the cellular ligand for this important NK cell activation receptor
15784725 NK cell-mediated induction of dendritic cell maturation is dependent on NKp30.
15728472 NKp30 is not only a triggering molecule essential for antitumor activity but is also a surface receptor involved in natural killer cell suicide.
15657183 NKG2D, NKp30, NKp44, and NKp46 acitvation affected by ligand-negative phenotype in bone marrow-derived progenitor cells, acquisition of cell-surface ligands during myeloid differentiation, defective expression of ligands on malignant transformation
14635045 CD59 is physically associated with NKp46 and NKp30 and activate human nk cell-mediated cytotoxicity.
12731048 Selective cross-talk among natural cytotoxicity receptors (NKp46, NKp30 and NKp44) in human natural killer cells.

AA Sequence

MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGT      1 - 70
PEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVL     71 - 140
LLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG             141 - 201
//

Text Mined References (75)

PMID Year Title
26582946 2016 Group 2 Innate Lymphoid Cells Express Functional NKp30 Receptor Inducing Type 2 Cytokine Production.
26241657 2015 NKP30-B7-H6 Interaction Aggravates Hepatocyte Damage through Up-Regulation of Interleukin-32 Expression in Hepatitis B Virus-Related Acute-On-Chronic Liver Failure.
26094914 2015 NKp30 isoforms in patients with chronic hepatitis C virus infection.
25991472 2015 Expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated NK cells from healthy donors according to CMV-serostatus and age.
25877893 2015 Clinical impact of the NKp30/B7-H6 axis in high-risk neuroblastoma patients.
25824372 2015 Inhibition of NKp30- and 2B4-mediated NK cell activation by evolutionary different human and bovine CEACAM1 receptors.
25315772 2014 Tumor-released Galectin-3, a soluble inhibitory ligand of human NKp30, plays an important role in tumor escape from NK cell attack.
25001651 Allogeneic and xenogeneic anti-tumor effect of callithrix jacchus natural killer cells is dependent on NKp30 and B7-H6 interaction.
24882570 2014 Up-regulation of DNAM-1 and NKp30, associated with improvement of NK cells activation after long-term culture of mononuclear cells from patients with ovarian neoplasia.
24275655 2014 Homo-oligomerization of the activating natural killer cell receptor NKp30 ectodomain increases its binding affinity for cellular ligands.
24139398 2013 The NK receptor NKp30 mediates direct fungal recognition and killing and is diminished in NK cells from HIV-infected patients.
24133212 2013 A soluble fragment of the tumor antigen BCL2-associated athanogene 6 (BAG-6) is essential and sufficient for inhibition of NKp30 receptor-dependent cytotoxicity of natural killer cells.
23884468 2013 NCR3/NKp30 contributes to pathogenesis in primary Sjogren's syndrome.
23687088 2013 Induction of B7-H6, a ligand for the natural killer cell-activating receptor NKp30, in inflammatory conditions.
23490421 2013 Different combinations of cytokines and activating receptor stimuli are required for human natural killer cell functional diversity.
23456936 2013 HHIP, HDAC4, NCR3 and RARB polymorphisms affect fetal, childhood and adult lung function.
23360454 2013 Differential expression of natural killer cell activating receptors in blood versus bone marrow in patients with monoclonal gammopathy.
23345327 2013 Human NK cells selective targeting of colon cancer-initiating cells: a role for natural cytotoxicity receptors and MHC class I molecules.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23066150 2012 Mimicking an induced self phenotype by coating lymphomas with the NKp30 ligand B7-H6 promotes NK cell cytotoxicity.
23059620 2012 Preparation of soluble isotopically labeled NKp30, a human natural cytotoxicity receptor, for structural studies using NMR.
23028341 2012 Genome-wide association study for serum complement C3 and C4 levels in healthy Chinese subjects.
22851709 2012 An NKp30-based chimeric antigen receptor promotes T cell effector functions and antitumor efficacy in vivo.
22807449 2012 The stalk domain and the glycosylation status of the activating natural killer cell receptor NKp30 are important for ligand binding.
22360401 2012 Changes in natural killer cell subsets in pediatric liver transplant recipients.
22221078 2012 Important role for NKp30 in synapse formation and activation of NK cells.
22044312 2012 Expression of natural killer cell activating receptors in patients with chronic lymphocytic leukaemia.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21552268 2011 Alternatively spliced NKp30 isoforms affect the prognosis of gastrointestinal stromal tumors.
21444796 2011 Crystal structure of human natural cytotoxicity receptor NKp30 and identification of its ligand binding site.
21422170 2011 Structure of the human activating natural cytotoxicity receptor NKp30 bound to its tumor cell ligand B7-H6.
20812318 2010 Increased natural killer cell cytotoxicity and NKp30 expression protects against hepatitis C virus infection in high-risk individuals and inhibits replication in vitro.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20663564 2010 A strong genetic association between the tumor necrosis factor locus and proliferative vitreoretinopathy: the retina 4 project.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19580844 2009 Analysis of NK cell/DC interaction in NK-type lymphoproliferative disease of granular lymphocytes (LDGL): role of DNAM-1 and NKp30.
19551844 2009 Myeloid derived suppressor cells inhibit natural killer cells in patients with hepatocellular carcinoma via the NKp30 receptor.
19528259 2009 The B7 family member B7-H6 is a tumor cell ligand for the activating natural killer cell receptor NKp30 in humans.
19143814 2009 Several loci in the HLA class III region are associated with T1D risk after adjusting for DRB1-DQB1.
19079260 2009 Genome-wide association yields new sequence variants at seven loci that associate with measures of obesity.
18852879 2008 Dendritic cells release HLA-B-associated transcript-3 positive exosomes to regulate natural killer function.
18802053 2008 Umbilical cord blood T cells express multiple natural cytotoxicity receptors after IL-15 stimulation, but only NKp30 is functional.
18713971 2008 Critical and differential roles of NKp46- and NKp30-activating receptors expressed by uterine NK cells in early pregnancy.
18275895 2008 Up-regulation of NK cell activating receptors following allogeneic hematopoietic stem cell transplantation under a lymphodepleting reduced intensity regimen is associated with elevated IL-15 levels.
18157817 2008 Identification and hormonal regulation of a novel form of NKp30 in human endometrial epithelium.
18092004 2007 Expression analysis of the ligands for the Natural Killer cell receptors NKp30 and NKp44.
18055229 2007 Human leukocyte antigen-B-associated transcript 3 is released from tumor cells and engages the NKp30 receptor on natural killer cells.
18023431 2008 Expressions of natural cytotoxicity receptors and NKG2D on decidual natural killer cells in patients having spontaneous abortions.
17436233 2007 A Duffy binding-like domain is involved in the NKp30-mediated recognition of Plasmodium falciparum-parasitized erythrocytes by natural killer cells.
17208487 2007 Association analyses of NCR3 polymorphisms with P. falciparum mild malaria.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16690951 2006 Human congenital infection with Trypanosoma cruzi induces phenotypic and functional modifications of cord blood NK cells.
16362817 2006 LST1 and NCR3 expression in autoimmune inflammation and in response to IFN-gamma, LPS and microbial infection.
16304049 2006 Expression of the DNAM-1 ligands, Nectin-2 (CD112) and poliovirus receptor (CD155), on dendritic cells: relevance for natural killer-dendritic cell interaction.
16272287 2005 Interaction between human NK cells and bone marrow stromal cells induces NK cell triggering: role of NKp30 and NKG2D receptors.
15972650 2005 Evidence that the cellular ligand for the human NK cell activation receptor NKp30 is not a heparan sulfate glycosaminoglycan.
15784725 2005 NK-dependent DC maturation is mediated by TNFalpha and IFNgamma released upon engagement of the NKp30 triggering receptor.
15728472 2005 Tumor-induced apoptosis of human IL-2-activated NK cells: role of natural cytotoxicity receptors.
15657183 2005 Ligands for natural killer cell-activating receptors are expressed upon the maturation of normal myelomonocytic cells but at low levels in acute myeloid leukemias.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14635045 2003 CD59 is physically and functionally associated with natural cytotoxicity receptors and activates human NK cell-mediated cytotoxicity.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12731048 2003 Selective cross-talk among natural cytotoxicity receptors in human natural killer cells.
12486241 2002 Engagement of CD160 receptor by HLA-C is a triggering mechanism used by circulating natural killer (NK) cells to mediate cytotoxicity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11895890 2002 A view to a kill: signals triggering cytotoxicity.
11782277 2001 Identification of novel single nucleotide substitutions in the NKp30 gene expressed in human natural killer cells.
10941844 2000 Expression and cellular localization of the protein encoded by the 1C7 gene: a recently described component of the MHC.
10562324 1999 Identification and molecular characterization of NKp30, a novel triggering receptor involved in natural cytotoxicity mediated by human natural killer cells.
10202016 1999 A new member of the Ig superfamily and a V-ATPase G subunit are among the predicted products of novel genes close to the TNF locus in the human MHC.
8824804 1996 Genes in a 220-kb region spanning the TNF cluster in human MHC.