Property Summary

NCBI Gene PubMed Count 64
PubMed Score 245.88
PubTator Score 166.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 8.0e-10
osteosarcoma 7933 2.9e-06
Disease Target Count Z-score Confidence
Influenza 142 4.083 2.0
Cancer 2346 3.953 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.581 2.9e-06
ovarian cancer 1.100 8.0e-10

Gene RIF (56)

PMID Text
26714120 Intrahepatic NKp46 NK cells exhibited anti-HCV activity via cell-to-cell contact. The variation of the NKp46 proportion in individuals could be attributed to the diversity of HCV resistance observed in these individuals.
26554241 Expression of NKp46/NCR1 in NK cells was significantly higher in untreated severe aplastic anemia patients than those in remission SAA and controls. This may be the reason for the hyperfunction of the immune system in SAA patients.
26372382 Taken together, these results demonstrate that endogenous levels of IFN-alpha secreted by plasmacytoid dendritic cells induce natural killer cells to lyse HIV-1-infected autologous CD4+ primary T cells via the engagement of NKp46 and NKG2D.
26371250 Ncr1-Noe proteins accumulate in the endoplasmic reticulum, and that the expression of Ncr1-Noe proteins, but not WT Ncr1, leads to increased Helios expression
26232426 Data show that regulatory dendritic cells (regDC) restrain IFN-gamma secretion by NK cells through secretion of interleukin-10 (IL-10), engagement of MHC class I-specific inhibitory receptors, and the activating receptor NKp46.
25991472 Age and CMV serostatus influence the expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated natural killer cells.
25940096 NKp46 was thus involved in the production of serine proteases and interleukin-22 in human mast cells.
24824867 On CD56(+) CD3(-) cells, NKp44 and NKp46 expressions were high in the acute hepatitis E patients, whereas NKp30, NKp44, NKp46 and NKG2D were high in the recovered individuals.
24807109 Women, w/ or w/o endometriosis, having larger populations of cytotoxic CD16(+) uterine NK cells and/or higher populations of NKp46(+)CD56(+) cells may be at greater risk of infertility resulting from inflammatory environment during implantation or later
24769842 Downregulated NKG2D, NKp46, and DNAM-1 receptors associated with impaired NK cell effector function are important biomarkers of advanced disease with a poor prognosis in melanoma patients.
24673109 Balance between activating NKG2D, DNAM-1, NKp44 and NKp46 and inhibitory CD94/NKG2A receptors determine natural killer degranulation towards rheumatoid arthritis synovial fibroblasts.
23900021 NKp46 is expressed on CD4 lymphocytes in mycosis fungoides and Sezary syndrome.
23665989 NKp46 marks out pathologically activated natural killer cells, which may result from a loss of homeostatic control of activating receptor expression in hepatitis C virus.
23490421 Cytokine stimulation combined with natural killer cell receptor engagement are required for human natural killer cell functional diversity.
23429988 PLS3, Twist, KIR3DL2 and NKp46 gene expression can model efficient molecular Sezary syndrome diagnosis.
23311919 involved in cytokine production of CD56+ NK cells in the uterine endometrium
22715368 IL-15+IL-12 has an immunomodulatory effect on NK cell subsets from HIV-infected individuals viz down-regulation of iNKRs, elevation of activatory receptors NKp46 and NKG2D, and induction of coreceptor NKp80.
22621189 expressed in all investigated cases of transformed mycosis fungoides
22615207 We suggest that NKp46 dimerization contributes to NKp46-mediated lysis by NK cells.
22532190 NKp46 expression of hepatitis C virus replication controls the modulation of liver fibrosis.
22505144 Race and gender related variation found in NKp46 receptor expression with differential anti-hepatitis C virus immunity.
22496218 NK cells that respond with IFN-gamma and TNF-alpha cytokine production to HIV-1 gp120 peptides have reduced CD16 and NKp46 expression and have increased levels of CD57
22360401 NKp46 levels remain stable on the natural killer cells that persist at one week post-liver transplant in pediatric patients.
22253448 Role of runt-related transcription factor 3 (RUNX3) in transcription regulation of natural cytotoxicity receptor 1 (NCR1/NKp46), an activating natural killer (NK) cell receptor.
22231698 findings show that NK cells can significantly accelerate neutrophil apoptosis, and that this process is dependent on cell-cell contact and mediated by the activating NK cell receptor NKp46 and the Fas pathway
22212381 This study demonistrated that NCR1 expression on astrocytes in MS tissue.
22198715 important role in inhibition of liver fibrosis
22105417 decreased expression is associated with altered NK-cell function in pediatric transplant patients with PTLD
22044312 a precise analysis of clinical data showed a correlation between decreased NCR expression and poor prognosis factors such as low haemoglobin level, high (>30x10(9) per litre) lymphocyte count or elevated C-reactive protein
21849674 we investigate whether NKp46 is involved in the killing of human beta cells
21364281 NKp46 identifies a functionally distinct NKT subset in that appears to be directly susceptible to leukemic transformation when IL-15 is overexpressed.
21329668 NKp46 interacts with heparin and heparan sulfate, highly sulfated glycans, and multimeric alpha2,3-NeuAc-containing N-glycan; these glycans interact mainly with basic amino acids in NKp46.
21214542 Data show that an increase in 2B4-expressing NK cells and a decrease in NKp46(+) NK cells occurred following intramuscular influenza vaccination.
21191411 peripheral blood malignant CD4(+) T lymphocytes from patients with Sezary syndrome, an aggressive form of cutaneous T-cell lymphoma, express NKp46 at their cell surface
21030563 Data show that only NKp46 appeared involved in the NK response.
20638936 The balance of NKp44(+)/NKp46(+) NK cells is disrupted in intestinal mucosa of patients with Crohn's disease.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20023661 NKp46 is essential for the development of type 1 diabetes
19498463 On co-culture with some melanomas, activated CD4(+) T cells promoted NKG2D- and NKp46-dependent IFN-gamma secretion by NK cells, probably owing to the capture of NKG2D and NKp46 ligands from the tumour-cell surface (trogocytosis).
18941207 Brain-infiltrating natural killer (NK) cells might restrict innate and adaptive immune responses via elimination of resting microglia; this cell killing is dependent on cell contact, NKp46, and NKG2D.
18713971 differential, controlled role of NKp46- and NKp30-activating receptors expressed by uterine dNK that could be critical for the outcome of pregnancy
18275895 in NK cells cultured with IL-15, we observed an up-regulation of the activating receptors NKG2D, NKp30, and NKp46, associated with an increase in anti-tumor lytic activity.
18023431 Determined expressions of NKp46 in decidual natural killer cells in patients having spontaneous abortions.
17972960 There is a correlation between the malignant potential of the lesion and the expression of NKp46 ligands in the reticular dermis.
17875681 The natural cytotoxicity receptor NKp46 was required for the killing of all myeloma cell lines analyzed.
17056548 Vimentin is involved in binding of NKp46 to M. tuberculosis H37Ra-infected mononuclear phagocytes.
16690951 defect in cytotoxic effector function is associated with a reduced surface expression of activating NK receptors (NKp30, NKp46, and NKG2D) on CD56(dim) NK cells compared with uninfected newborns.
16262248 Results examine residues in NKp46 that may be involved in heparan sulfate binding on tumor cells.
15728472 NKp46 is not only a triggering molecule essential for antitumor activity but is also a surface receptor involved in natural killer cell suicide.
15657183 NKG2D, NKp30, NKp44, and NKp46 acitvation affected by ligand-negative phenotype in bone marrow-derived progenitor cells, acquisition of cell-surface ligands during myeloid differentiation, defective expression of ligands on malignant transformation
15328155 natural cytotoxicity receptor (NCR) and NK receptor member D of the lectin-like receptor family (NKG2D) were the key NK activating receptors for bone marrow-derived myeloma cell recognition
14635045 CD59 is physically associated with NKp46 and NKp30 and activate human nk cell-mediated cytotoxicity.
14504081 NKp46 interacts with both viral hemagglutinins and the unknown tumor ligands via different mechanisms.
12960161 crystal structure of the human natural killer (NK) cell activating receptor NKp46
12731048 Selective cross-talk among natural cytotoxicity receptors (NKp46, NKp30 and NKp44) in human natural killer cells.
11907104 The NKp46 receptor participates in NK cell-mediated lysis of cells infected with the intracellular pathogen Mycobacterium tuberculosis, an activity that is reduced in tuberculosis patients compared with findings in healthy donors.

AA Sequence

MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVD      1 - 70
RPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKV     71 - 140
TFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLV    141 - 210
TGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSR    211 - 280
KRTRERASRASTWEGRRRLNTQTL                                                  281 - 304
//

Text Mined References (66)

PMID Year Title
26714120 2016 Functional Behavior of NKp46-Positive Intrahepatic Natural Killer Cells Against Hepatitis C Virus Reinfection After Liver Transplantation.
26554241 2015 Expression of NK-Activating Receptor-NKp46/NCR1 on NK Cells in Patients with Severe Aplastic Anemia.
26372382 2015 Lysis of HIV-1-infected autologous CD4+ primary T cells by interferon-alpha-activated NK cells requires NKp46 and NKG2D.
26371250 2015 Expression, Function, and Molecular Properties of the Killer Receptor Ncr1-Noé.
26232426 2015 Regulatory Dendritic Cells Restrain NK Cell IFN-? Production through Mechanisms Involving NKp46, IL-10, and MHC Class I-Specific Inhibitory Receptors.
25991472 2015 Expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated NK cells from healthy donors according to CMV-serostatus and age.
25940096 2015 NKp46 regulates the production of serine proteases and IL-22 in human mast cells in urticaria pigmentosa.
24824867 2014 Increased expressions of NKp44, NKp46 on NK/NKT-like cells are associated with impaired cytolytic function in self-limiting hepatitis E infection.
24807109 2014 Characterization of uterine NK cells in women with infertility or recurrent pregnancy loss and associated endometriosis.
24769842 2014 Decreased expression of NKG2D, NKp46, DNAM-1 receptors, and intracellular perforin and STAT-1 effector molecules in NK cells and their dim and bright subsets in metastatic melanoma patients.
24673109 2014 Balance between activating NKG2D, DNAM-1, NKp44 and NKp46 and inhibitory CD94/NKG2A receptors determine natural killer degranulation towards rheumatoid arthritis synovial fibroblasts.
23900021 2014 NKp46-specific expression on skin-resident CD4(+) lymphocytes in mycosis fungoides and Sézary syndrome.
23665989 2014 The paradox of NKp46+ natural killer cells: drivers of severe hepatitis C virus-induced pathology but in-vivo resistance to interferon ? treatment.
23490421 2013 Different combinations of cytokines and activating receptor stimuli are required for human natural killer cell functional diversity.
23429988 2013 Use of PLS3, Twist, CD158k/KIR3DL2, and NKp46 gene expression combination for reliable Sézary syndrome diagnosis.
23311919 2013 Role of NKp46 expression in cytokine production by CD56-positive NK cells in the peripheral blood and the uterine endometrium.
22715368 2012 Effect of recombinant cytokines on the expression of natural killer cell receptors from patients with TB or/and HIV infection.
22621189 2012 CD158k/KIR3DL2 and NKp46 are frequently expressed in transformed mycosis fungoides.
22615207 2012 Dimerization of NKp46 receptor is essential for NKp46-mediated lysis: characterization of the dimerization site by epitope mapping.
22532190 2012 Natural killer p46High expression defines a natural killer cell subset that is potentially involved in control of hepatitis C virus replication and modulation of liver fibrosis.
22505144 2012 Race- and gender-related variation in natural killer p46 expression associated with differential anti-hepatitis C virus immunity.
22360401 2012 Changes in natural killer cell subsets in pediatric liver transplant recipients.
22253448 2012 Role of runt-related transcription factor 3 (RUNX3) in transcription regulation of natural cytotoxicity receptor 1 (NCR1/NKp46), an activating natural killer (NK) cell receptor.
22231698 2012 Human NK Cells induce neutrophil apoptosis via an NKp46- and Fas-dependent mechanism.
22212381 2012 Innate immunity in multiple sclerosis white matter lesions: expression of natural cytotoxicity triggering receptor 1 (NCR1).
22198715 2012 NKp46-mediated killing of human and mouse hepatic stellate cells attenuates liver fibrosis.
22105417 2012 Decreased NKp46 and NKG2D and elevated PD-1 are associated with altered NK-cell function in pediatric transplant patients with PTLD.
22044312 2012 Expression of natural killer cell activating receptors in patients with chronic lymphocytic leukaemia.
21849674 2011 Recognition and killing of human and murine pancreatic beta cells by the NK receptor NKp46.
21364281 2011 NKp46 identifies an NKT cell subset susceptible to leukemic transformation in mouse and human.
21329668 2011 Binding of natural cytotoxicity receptor NKp46 to sulfate- and ?2,3-NeuAc-containing glycans and its mutagenesis.
21214542 2011 Expansion of 2B4+ natural killer (NK) cells and decrease in NKp46+ NK cells in response to influenza.
21191411 2011 Expression and function of the natural cytotoxicity receptor NKp46 on circulating malignant CD4+ T lymphocytes of Sézary syndrome patients.
21030563 2011 NKp46 and DNAM-1 NK-cell receptors drive the response to human cytomegalovirus-infected myeloid dendritic cells overcoming viral immune evasion strategies.
20638936 2010 Imbalance of NKp44(+)NKp46(-) and NKp44(-)NKp46(+) natural killer cells in the intestinal mucosa of patients with Crohn's disease.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20023661 2010 The activating receptor NKp46 is essential for the development of type 1 diabetes.
19498463 2009 Tumour-experienced T cells promote NK cell activity through trogocytosis of NKG2D and NKp46 ligands.
18941207 2008 Human NK cells kill resting but not activated microglia via NKG2D- and NKp46-mediated recognition.
18713971 2008 Critical and differential roles of NKp46- and NKp30-activating receptors expressed by uterine NK cells in early pregnancy.
18275895 2008 Up-regulation of NK cell activating receptors following allogeneic hematopoietic stem cell transplantation under a lymphodepleting reduced intensity regimen is associated with elevated IL-15 levels.
18023431 2008 Expressions of natural cytotoxicity receptors and NKG2D on decidual natural killer cells in patients having spontaneous abortions.
17972960 2008 Expression of ligands to NKp46 in benign and malignant melanocytes.
17875681 2007 The requirement for DNAM-1, NKG2D, and NKp46 in the natural killer cell-mediated killing of myeloma cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17056548 2006 Vimentin expressed on Mycobacterium tuberculosis-infected human monocytes is involved in binding to the NKp46 receptor.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16690951 2006 Human congenital infection with Trypanosoma cruzi induces phenotypic and functional modifications of cord blood NK cells.
16262248 2005 Characterization of the heparin/heparan sulfate binding site of the natural cytotoxicity receptor NKp46.
15728472 2005 Tumor-induced apoptosis of human IL-2-activated NK cells: role of natural cytotoxicity receptors.
15657183 2005 Ligands for natural killer cell-activating receptors are expressed upon the maturation of normal myelomonocytic cells but at low levels in acute myeloid leukemias.
15654827 2005 Effects of prolactin and cortisol on natural killer (NK) cell surface expression and function of human natural cytotoxicity receptors (NKp46, NKp44 and NKp30).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15328155 2005 HLA class I, NKG2D, and natural cytotoxicity receptors regulate multiple myeloma cell recognition by natural killer cells.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14754506 Human natural killer cell receptors: insights into their molecular function and structure.
14635045 2003 CD59 is physically and functionally associated with natural cytotoxicity receptors and activates human NK cell-mediated cytotoxicity.
14504081 2004 The mechanisms controlling the recognition of tumor- and virus-infected cells by NKp46.
12960161 2003 Crystal structure of the human natural killer (NK) cell activating receptor NKp46 reveals structural relationship to other leukocyte receptor complex immunoreceptors.
12951052 2003 Structure of the human NK cell triggering receptor NKp46 ectodomain.
12731048 2003 Selective cross-talk among natural cytotoxicity receptors in human natural killer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10049942 1999 NKp44, a triggering receptor involved in tumor cell lysis by activated human natural killer cells, is a novel member of the immunoglobulin superfamily.
9730896 1998 Molecular cloning of NKp46: a novel member of the immunoglobulin superfamily involved in triggering of natural cytotoxicity.
9625766 1998 NKp44, a novel triggering surface molecule specifically expressed by activated natural killer cells, is involved in non-major histocompatibility complex-restricted tumor cell lysis.
9314561 1997 p46, a novel natural killer cell-specific surface molecule that mediates cell activation.