1. Home
  2. Targets
  3. transcription factor
  4. transcription cofactor
  5. Nuclear receptor corepressor 1

Tchem Nuclear receptor corepressor 1

Mediates transcriptional repression by certain nuclear receptors. Part of a complex which promotes histone deacetylation and the formation of repressive chromatin structures which may impede the access of basal transcription factors. Participates in the transcriptional repressor activity produced by BCL6.

This gene encodes a protein that mediates ligand-independent transcription repression of thyroid-hormone and retinoic-acid receptors by promoting chromatin condensation and preventing access of the transcription machinery. It is part of a complex which also includes histone deacetylases and transcriptional regulators similar to the yeast protein Sin3p. This gene is located between the Charcot-Marie-Tooth and Smith-Magenis syndrome critical regions on chromosome 17. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 17 and 20.[provided by RefSeq, Jun 2010]

 Comments

Property Summary

NCBI Gene PubMed Count 144
PubMed Score 286.66
PubTator Score 241.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 4.306 2.2

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.300 1.6e-06
astrocytic glioma 1.600 8.1e-03
ependymoma 1.500 1.6e-02
oligodendroglioma 1.800 5.1e-03
psoriasis -1.500 6.5e-04
osteosarcoma 2.062 2.0e-03
pancreatic ductal adenocarcinoma liver m... 1.258 8.2e-03
intraductal papillary-mucinous adenoma (... 1.400 2.0e-04
intraductal papillary-mucinous carcinoma... 1.500 1.5e-03
subependymal giant cell astrocytoma -1.086 1.0e-02
Pick disease 1.900 3.8e-05
acute myeloid leukemia 1.600 4.1e-02
ovarian cancer -1.500 1.2e-06
Breast cancer -1.100 3.1e-04
pituitary cancer -1.300 4.2e-02

Synonym

Accession O75376 B3DLF8 E9PGV6 Q86YY0 Q9UPV5 Q9UQ18 N-CoR
Symbols N-CoR
TRAC1
N-CoR1
hN-CoR
PPP1R109

Gene

NCOR1

PANTHER Protein Class (2)

PDB

4WVD   2EQR   3H52   3KMZ   3N00   4MDD  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

 UniProt Keyword (16)

See all...

 GO Function (7)

 GO Component (6)

 GO Process (11)

See all...

 Compartment GO Term (46)

See all...

 MGI Phenotype (15)

See all...

 HCA RNA Cell Line (56)

See all...

Pathway (70)

See all...

Protein-protein Interaction (24)

MED26   UBB   UBC   PPARG   PSEN2   RBPJ   ERBB4   MED1   NCOA1   SMAD2   MED27   HDAC7   NCSTN   HDAC10   APH1A   MED8   MED15   HELZ2   HDAC9   MED23   HDAC5   MED16   NCOR2   NCOA3  

Drug (2)

Structure of vorinostat

vorinostat
pKi 7.92

Structure of romidepsin

romidepsin
pKi 9.82

Gene RIF (78)

PMID Text
26729869 NCoR depletion enhances cancer cell invasion and increases tumor growth and metastatic potential.
26663086 Data suggest that complexes of HDAC3-H1.3 with NCOR1 and NCOR2/SMRT accumulate on chromatin in synchronized HeLa cells in late G2 phase and mitosis; deacetylation activity of HDAC3 is activated via phosphorylation of Ser-424 by CK2 only in mitosis.
25928846 The co-localization of AML1-ETO with the N-CoR co-repressor to be primarily on genomic regions distal to transcriptional start sites. (NcoR1)
25823659 loss of nuclear NCoR results in upregulation of a specific cancer-related genetic signature, and is significantly associated with malignant melanoma progression.
24840043 Data suggest that direct interactions of HLCS (holocarboxylase synthetase) with NCOR1 (nuclear receptor corepressor 1) and HDAC1 (histone deacetylase 1) contribute toward transcriptional repression of repeats, presumably increasing genome stability.
24335696 Low NCoR expression is associated with glioblastoma.
24315104 Study shows that NCoR1 is a key target of proteolysis and physically interacts with the transcription factor CREB, the genome-wide map described here ties proteolysis in mammalian cells to active enhancers and to promoters of specific gene families.
23940660 Site directed mutagenic analysis of N-CoR identified serine 1450 as the crucial residue whose phosphorylation by Akt was essential for the misfolding and loss of N-CoR protein.
23428870 NCOR1 and HDAC3 are instrumental in the repression of glucocorticoid receptor gene transcription.
23295231 The aberrant cytoplasmic expression of NCoR1 in retinoblastoma appears to be associated with the proliferative and/or dedifferentiated properties of retinoblastoma.
23129261 These results uncover a regulatory mechanism by which PKA positively modulates NCoR function in transcriptional regulation in prostate cancer.
22944139 Corepressor molecules NCoR and SMRT are present at 1,25(OH)2D3 activated gene enhancers
22675025 CK2alpha-NCoR cascade selectively represses the transcription of IP-10 and promotes oncogenic signaling in human esophageal cancer cells.
22651256 analysis of regulation of small ubiquitin-like modifier-1, nuclear receptor coreceptor, histone deacetylase 3, and peroxisome proliferator-activated receptor-gamma in human adipose tissue
22622808 A novel mechanism by which overexpression of estrogen receptor (ER) beta through NCoR is able to down regulate ER alpha gene expression, thus blocking ER alpha's driving role on breast cancer cell growth.
22514634 Findings suggest that N-CoR-induced repression of Flt3 might be crucial for limiting the contribution of the Flt3 signaling pathway on the growth potential of leukemic cells.
22349439 PCOS rat models also showed alterations of PPARG1, NCOR1, and HDAC3 mRNA expression and methylation changes of PPARG1 and NCOR1, consistent with the results from humans.
22337871 Regulated HDAC3 degradation serves as a buffering mechanism to protect independent formation of N-CoR and SMRT corepressor complexes.
22190034 HIV-1 Vif is identified to have a physical interaction with nuclear receptor corepressor 1 (NCOR1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21987803 the aberrant recruitment of NCOR1 by TRbeta mutants leads to clinical resistance to thyroid hormone (RTH)
21966475 Data suggest a possible role of misfolded N-CoR protein in the activation of oncogenic survival pathway in non-small cell lung cancer cells.
21525722 ERbeta and its co-regulators p300 and NCoR are expressed in human transitional cell bladder cancer
21518914 data strongly support a model in which EBNA2 association with NCoR-deficient RBPJ enhances transcription and EBNALP dismisses NCoR and RBPJ repressive complexes from enhancers
21389087 Differential interaction of NCoR1 with TR isoforms accounted for the TR isoformdependent regulation of adipogenesis and that aberrant interaction of NCoR1 with TR could underlie the pathogenesis of lipid disorders in hypothyroidism.
21143702 We immunohistochemically analyzed the expression of NCOR1 and 2 as well as HDAC1, 2, and 3 on a tissue microarray comprising tumor samples from 283 astrocytic gliomas
21131350 Aberrant corepressor interactions implicated in PML-RAR(alpha) and PLZF-RAR(alpha) leukemogenesis reflect an altered recruitment and release of specific NCoR and SMRT splice variants.
20974212 These data support the hypothesis that NCoR might control a cell cycle dependent regulation of expression androgen receptor target genes in prostate cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587609 Amino-terminal A/B domain deletion facilitated the in vitro binding of nuclear receptor CoR with wild-type PPARG2.
20581824 Study reports the crystal structure of a nuclear receptor-co-repressor (N-CoR) interaction domain 1 (ID1) peptide bound to truncated human Rev-erbalpha ligand-binding domain.
20466759 Elevated NCOR1 disrupts PPARalpha/gamma signaling and is associated with prostate cancer.
20181716 The authors established an interaction of E8;E2C with an NCoR1/HDAC3 complex and demonstrated that this interaction requires the wild-type E8 open reading frame.
20003447 Observational study of gene-disease association. (HuGE Navigator)
19955185 hPPARalpha SUMOylation on lysine 185 down-regulates its trans-activity through the selective recruitment of NCoR
19913121 Observational study of gene-disease association. (HuGE Navigator)
19781322 NCOR1 protein expression level predicts response to endocrine therapy as first-line treatment for breast cancer patients on relapse.
19608741 NCoR1 expression is required to maintain IEC in a proliferative state, and PEDF is a novel transcriptional target for NCoR1 repressive action
19414341 Up-regulation of nuclear receptor corepressor is associated with progestin-induced growth suppression of endometrial hyperplasia and carcinoma
19183483 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19126649 NCOR1 is a selective regulator of nuclear receptors, notably PPARgamma and VDR, and contributes to their loss of sensitivity.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19048289 NCoR was expressed in the cytoplasm of colorectal carcinoma-associated myofibroblasts, but was rarely noted in myofibroblasts of normal mucosa or adenomas.
18852122 These findings show that AR antagonists can enhance corepressor recruitment by stabilizing a distinct antagonist conformation of the AR coactivator/corepressor binding site.
18832723 apoptotic cells induce PPARgamma sumoylation to attenuate the removal of NCoR, thereby blocking transactivation of NF-kappaB.
18669643 Data show that, at sufficiently high concentration, the NR corepressor (NCoR) influences the activity of the liver X receptor (LXR) even in the presence of a potent full agonist that destabilizes NCoR binding.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18637017 A point mutation (S296R) in the amino-terminal domain of the androgen receptor (AR) can decrease the ligand specificity of the AR and alter the interaction between serine296arginine and the nuclear receptor co-repressor 1 (N-coR).
18632669 SMRT and NCoR have important roles in the regulation of beta-catenin-TCF4-mediated gene transcription
18586123 ETO family member-mediated oligomerization and repression can be distinct events and that interaction between ETO family members and hSIN3B or N-CoR may not necessarily strengthen transcriptional repression.
18362166 Vitamin D receptor (VDR) with the retinoid X receptor (RXR) recruits NCoR and SMRT strictly in a VDR agonist-dependent manner.
18052923 both SMRT and N-CoR are limited in cells and knocking down either of them results in co-repressor-free TR and consequently de-repression of TR target genes
17768398 Data support a role for N-CoR in erythroid differentiation and suggest that N-CoR is required for the induction of a key enzyme involved in heme synthesis.
17630505 Data show that IKKalpha phosphorylates the homologous N-CoR corepressor in serines 2345 and 2348 creating a functional 14-3-3 binding domain (RK(p)S(2348)KSP).
17073437 first report of a direct interaction between N-CoR and CBP, and suggests that the role of N-CoR in mediating transcriptional events may be more complex than previously anticipated
16914745 The repression mechanisms by the nuclear receptor corepressor (N-CoR) of steroid hormone receptor (SHR)-mediated transactivation were examined.
16849648 RB7 and butyrate induce dissociation of HDAC3 (but not HDAC1 or HDAC2) and its adaptor protein NCoR.
16730330 Results provide evidence to show that the N-CoR/HDAC3 co-repressor complex is involved in the aberrant transcription regulation in PML-RARalpha-expressing cells.
16373395 SMRT and N-CoR corepressors are involved in transcriptional regulation by both agonist- and antagonist-bound AR and regulate the magnitude of hormone response, at least in part, by competing with coactivators.
16216492 N-CoR and TRbeta cooperate in the regulation of the TSHbeta gene and this ligand-dependent repression is mediated by the LXXLL motif in N-CoR
16195251 SAFB1 was shown to interact directly with the nuclear receptor corepressor N-CoR.
16141343 mechanism by which the estrogen-ER complex markedly reduces the level of N-CoR through a process involving the up-regulation of Siah2 and the subsequent targeting of N-CoR for proteasomal degradation
16024779 N-CoR together with JMJD2A could play a role in repressing achaete scute-like homologue 2 (ASCL2) expression in various tissues.
15802375 N-CoR and SMRT play an active role in preventing tamoxifen from stimulating proliferation in breast cancer cells through repression of a subset of target genes involved in ERalpha function and cell proliferation
15761026 the N-CoR/HDAC3 complex has a role in regulating the expression of genes involved in circadian rhythm by functioning as corepressor for Rev-erbalpha
15695367 the DAD domain of N-CoR is singularly essential for repression by the thyroid hormone receptor
15598662 NCoR is a physiological regulator of the AR; the N-terminal surface of the AR-mediating NCoR recruitment was distinct from tau5 and from the FXXLF motif that mediates agonist-induced N-C-terminal interaction
15561719 THAP7 coimmunoprecipitates with histone deacetylase 3 and the nuclear hormone receptor corepressor and represses transcription
15377655 N-CoR utilizes repression domains I and III for interaction and co-repression with ETO
12890497 associates with CHD1 and histone deacetylase as well as with RNA splicing proteins
12861000 N-CoR/histone deacetylase 3 complex is required for repression by thyroid hormone receptor
12648520 N-CoR functions not merely as a repressor of basal transcription, but rather as a modulator of both basal and ligand-activated transcription of genes controlled by RAR/RXR heterodimers in a dose-dependent manner
12466959 recruited by prohibitin for transcriptional repression
12150997 Exchange of N-CoR corepressor and Tip60 coactivator complexes links gene expression by NF-kappaB and beta-amyloid precursor protein.
12089345 These results demonstrate that AR, in contrast to other SHRs, is regulated by NCoR
12077342 Mammalian PRP4 kinase copurifies and interacts with components of both the U5 snRNP and the N-CoR deacetylase complexes.
11931768 Results show that the N-CoR-HDAC3 complex inhibits JNK activation through the associated GPS2 subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP-1 function.
11903058 Nuclear receptor corepressor-dependent repression of peroxisome-proliferator-activated receptor delta-mediated transactivation
9724795 This paper describes the cloning of the full-length human NCOR1 cDNA.

AA Sequence 

MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPS      1 - 70
LLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAAVLPLVHPLPEGLRAS     71 - 140
ADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLE    141 - 210
EEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIK    211 - 280
TNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIR    281 - 350
KQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINM    351 - 420
NGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKAL    421 - 490
VRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDEKEDSKENTKEKDKIDGTAEE    491 - 560
TEEREQATPRGRKTANSQGRRKGRITRSMTNEAAAASAAAAAATEEPPPPLPPPPEPISTEPVETSRWTE    561 - 630
EEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKTSRKPREERDVSQCE    631 - 700
SVASTVSAQEDEDIEASNEEENPEDSEVEAVKPSEDSPENATSRGNTEPAVELEPTTETAPSTSPSLAVP    701 - 770
STKPAEDESVETQVNDSISAETAEQMDVDQQEHSAEEGSVCDPPPATKADSVDVEVRVPENHASKVEGDN    771 - 840
TKERDLDRASEKVEPRDEDLVVAQQINAQRPEPQSDNDSSATCSADEDVDGEPERQRMFPMDSKPSLLNP    841 - 910
TGSILVSSPLKPNPLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQ    911 - 980
EQIDLECRSSTSPCGTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPS    981 - 1050
FIMGGSISQGTPGTYLTSHNQASYTQETPKPSVGSISLGLPRQQESAKSATLPYIKQEEFSPRSQNSQPE   1051 - 1120
GLLVRAQHEGVVRGTAGAIQEGSITRGTPTSKISVESIPSLRGSITQGTPALPQTGIPTEALVKGSISRM   1121 - 1190
PIEDSSPEKGREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLKRSYESVEGNIKQGMSM   1191 - 1260
RESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATTESFEDGLKYPKQIKRESPPIRAFEG   1261 - 1330
AITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIK   1331 - 1400
HNVKSLITGPSKLSRGMPPLEIVPENIKVVERGKYEDVKAGETVRSRHTSVVSSGPSVLRSTLHEAPKAQ   1401 - 1470
LSPGIYDDTSARRTPVSYQNTMSRGSPMMNRTSDVTISSNKSTNHERKSTLTPTQRESIPAKSPVPGVDP   1471 - 1540
VVSHSPFDPHHRGSTAGEVYRSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLYAMENTR   1541 - 1610
QTILNDYITSQQMQVNLRPDVARGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHPGGTSTPPMDRITY   1611 - 1680
IPGTQITFPPRPYNSASMSPGHPTHLAAAASAEREREREREKERERERIAAASSDLYLRPGSEQPGRPGS   1681 - 1750
HGYVRSPSPSVRTQETMLQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPAGGPSISQGLPASRYNTAADA   1751 - 1820
LAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKTLEVEKRSVQCLYTSSAFPSG   1821 - 1890
KPQPHSSVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSS   1891 - 1960
LSSHRYETPSDAIEVISPASSPAPPQEKLQTYQPEVVKANQAENDPTRQYEGPLHHYRPQQESPSPQQQL   1961 - 2030
PPSSQAEGMGQVPRTHRLITLADHICQIITQDFARNQVSSQTPQQPPTSTFQNSPSALVSTPVRTKTSNR   2031 - 2100
YSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQ   2101 - 2170
RGAEPAEQRNDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPA   2171 - 2240
VTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSQPMGVVPGTANTSVVTSGETRRE   2241 - 2310
EGDPSPHSGGVCKPKLISKSNSRKSKSPIPGQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGS   2311 - 2380
TQFPYNPLTMRMLSSTPPTPIACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD             2381 - 2440
//

Text Mined References (167)

PMID Year Title
26729869 2016 Autoregulatory loop of nuclear corepressor 1 expression controls invasion, tumor growth, and metastasis.
26663086 2016 Mitotic Activation of a Novel Histone Deacetylase 3-Linker Histone H1.3 Protein Complex by Protein Kinase CK2.
26120082 2015 Broad Anti-tumor Activity of a Small Molecule that Selectively Targets the Warburg Effect and Lipogenesis.
25928846 2015 Genome-wide co-occupancy of AML1-ETO and N-CoR defines the t(8;21) AML signature in leukemic cells.
25823659 2015 Cytoplasmic accumulation of NCoR in malignant melanoma: consequences of altered gene repression and prognostic significance.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25303530 2014 Enhancer activation requires trans-recruitment of a mega transcription factor complex.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24840043 2014 Holocarboxylase synthetase interacts physically with nuclear receptor co-repressor, histone deacetylase 1 and a novel splicing variant of histone deacetylase 1 to repress repeats.
24335696 2014 NCoR controls glioblastoma tumor cell characteristics.
24315104 2013 Genome-wide map of nuclear protein degradation shows NCoR1 turnover as a key to mitochondrial gene regulation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23940660 2013 Akt-induced phosphorylation of N-CoR at serine 1450 contributes to its misfolded conformational dependent loss (MCDL) in acute myeloid leukemia of the M5 subtype.
23911289 2013 A hybrid mechanism of action for BCL6 in B cells defined by formation of functionally distinct complexes at enhancers and promoters.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23428870 2013 Ligand-induced repression of the glucocorticoid receptor gene is mediated by an NCoR1 repression complex formed by long-range chromatin interactions with intragenic glucocorticoid response elements.
23372760 2013 Structural and functional analysis of the DEAF-1 and BS69 MYND domains.
23295231 2013 Aberrant nuclear repressor coreceptor 1 localization in human retinoblastoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23129261 2013 Protein kinase A phosphorylates NCoR to enhance its nuclear translocation and repressive function in human prostate cancer cells.
22944139 2013 Corepressors (NCoR and SMRT) as well as coactivators are recruited to positively regulated 1?,25-dihydroxyvitamin D3-responsive genes.
22675025 2012 Nuclear hormone receptor corepressor promotes esophageal cancer cell invasion by transcriptional repression of interferon-?-inducible protein 10 in a casein kinase 2-dependent manner.
22651256 2012 Regulation of small ubiquitin-like modifier-1, nuclear receptor coreceptor, histone deacetylase 3, and peroxisome proliferator-activated receptor-? in human adipose tissue.
22622808 2012 Estrogen receptor beta binds Sp1 and recruits a corepressor complex to the estrogen receptor alpha gene promoter.
22514634 2012 Role of misfolded N-CoR mediated transcriptional deregulation of Flt3 in acute monocytic leukemia (AML)-M5 subtype.
22349439 2012 A molecular mechanism underlying ovarian dysfunction of polycystic ovary syndrome: hyperandrogenism induces epigenetic alterations in the granulosa cells.
22337871 2012 Regulated clearance of histone deacetylase 3 protects independent formation of nuclear receptor corepressor complexes.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21987803 2011 Resistance to thyroid hormone is modulated in vivo by the nuclear receptor corepressor (NCOR1).
21966475 2011 Role of chaperone mediated autophagy (CMA) in the degradation of misfolded N-CoR protein in non-small cell lung cancer (NSCLC) cells.
21525722 2011 Expression of ER? and its co-regulators p300 and NCoR in human transitional cell bladder cancer.
21518914 2011 EBV nuclear antigen EBNALP dismisses transcription repressors NCoR and RBPJ from enhancers and EBNA2 increases NCoR-deficient RBPJ DNA binding.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21389087 2011 NCoR1 regulates thyroid hormone receptor isoform-dependent adipogenesis.
21269460 2011 Initial characterization of the human central proteome.
21258344 2011 Chemoproteomics profiling of HDAC inhibitors reveals selective targeting of HDAC complexes.
21143702 2011 Expression of nuclear receptor corepressors and class I histone deacetylases in astrocytic gliomas.
21131350 2011 Aberrant corepressor interactions implicated in PML-RAR(alpha) and PLZF-RAR(alpha) leukemogenesis reflect an altered recruitment and release of specific NCoR and SMRT splice variants.
20974212 2011 Cell cycle regulated expression of NCoR might control cyclic expression of androgen responsive genes in an immortalized prostate cell line.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20587609 2010 The role of the amino-terminal domain in the interaction of unliganded peroxisome proliferator-activated receptor gamma-2 with nuclear receptor co-repressor.
20581824 2010 Structure of Rev-erbalpha bound to N-CoR reveals a unique mechanism of nuclear receptor-co-repressor interaction.
20543827 2010 A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor.
20466759 2010 Elevated NCOR1 disrupts PPARalpha/gamma signaling in prostate cancer and forms a targetable epigenetic lesion.
20388878 2010 MicroRNA cluster 221-222 and estrogen receptor alpha interactions in breast cancer.
20181716 2010 NCoR1 mediates papillomavirus E8;E2C transcriptional repression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20003447 2009 Nuclear receptor coregulator SNP discovery and impact on breast cancer risk.
19955185 2010 SUMOylation of human peroxisome proliferator-activated receptor alpha inhibits its trans-activity through the recruitment of the nuclear corepressor NCoR.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19781322 2009 Nuclear corepressor 1 expression predicts response to first-line endocrine therapy for breast cancer patients on relapse.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19608741 2009 Nuclear receptor co-repressor is required to maintain proliferation of normal intestinal epithelial cells in culture and down-modulates the expression of pigment epithelium-derived factor.
19414341 2009 Up-regulation of nuclear receptor corepressor (NCoR) in progestin-induced growth suppression of endometrial hyperplasia and carcinoma.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19183483 2009 Screening and association testing of common coding variation in steroid hormone receptor co-activator and co-repressor genes in relation to breast cancer risk: the Multiethnic Cohort.
19126649 2009 Elevated NCOR1 disrupts a network of dietary-sensing nuclear receptors in bladder cancer cells.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19048289 2009 Expression of estrogen receptor co-regulators NCoR and PELP1 in epithelial cells and myofibroblasts of colorectal carcinomas: cytoplasmic translocation of NCoR in epithelial cells correlates with better [corrected] prognosis.
19032343 2009 Ski co-repressor complexes maintain the basal repressed state of the TGF-beta target gene, SMAD7, via HDAC3 and PRMT5.
18852122 2008 Structural basis for nuclear receptor corepressor recruitment by antagonist-liganded androgen receptor.
18832723 2008 Sumoylation of peroxisome proliferator-activated receptor gamma by apoptotic cells prevents lipopolysaccharide-induced NCoR removal from kappaB binding sites mediating transrepression of proinflammatory cytokines.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18669643 2008 Selective partial agonism of liver X receptor alpha is related to differential corepressor recruitment.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18637017 2008 An S296R mutation in the human androgen receptor causes activation of the receptor by non-androgenic steroids and stronger inhibition by the nuclear receptor corepressor N-coR.
18632669 2008 Silencing mediator for retinoid and thyroid hormone receptor and nuclear receptor corepressor attenuate transcriptional activation by the beta-catenin-TCF4 complex.
18586123 2008 Transcriptional repression by leukaemia-associated ETO family members can be independent of oligomerization and coexpressed hSIN3B and N-CoR.
18362166 2008 Vitamin D-dependent recruitment of corepressors to vitamin D/retinoid X receptor heterodimers.
18326024 2008 Histone deacetylase 3 localizes to the mitotic spindle and is required for kinetochore-microtubule attachment.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18052923 2008 The functional relationship between co-repressor N-CoR and SMRT in mediating transcriptional repression by thyroid hormone receptor alpha.
17768398 2007 A critical role for the co-repressor N-CoR in erythroid differentiation and heme synthesis.
17630505 2007 Aberrant cytoplasmic localization of N-CoR in colorectal tumors.
17519354 2007 Novel regulatory role for human Acf1 in transcriptional repression of vitamin D3 receptor-regulated genes.
17505061 2007 Sirtuin 1 is required for antagonist-induced transcriptional repression of androgen-responsive genes by the androgen receptor.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
17452463 2007 Regulation of P-TEFb elongation complex activity by CDK9 acetylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17073437 2006 Direct association between the CREB-binding protein (CBP) and nuclear receptor corepressor (N-CoR).
16980585 2006 A novel histone deacetylase pathway regulates mitosis by modulating Aurora B kinase activity.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16914745 2006 Nuclear compartmentalization of N-CoR and its interactions with steroid receptors.
16849648 2006 Short-chain fatty acids induce gamma-globin gene expression by displacement of a HDAC3-NCoR repressor complex.
16730330 2006 Histone deacetylase 3 (HDAC3) is recruited to target promoters by PML-RARalpha as a component of the N-CoR co-repressor complex to repress transcription in vivo.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16606617 2006 Additional sex comb-like 1 (ASXL1), in cooperation with SRC-1, acts as a ligand-dependent coactivator for retinoic acid receptor.
16373395 2006 The corepressors silencing mediator of retinoid and thyroid hormone receptor and nuclear receptor corepressor are involved in agonist- and antagonist-regulated transcription by androgen receptor.
16216492 2005 An LXXLL motif in nuclear receptor corepressor mediates ligand-induced repression of the thyroid stimulating hormone-beta gene.
16195251 2006 Scaffold attachment factor SAFB1 suppresses estrogen receptor alpha-mediated transcription in part via interaction with nuclear receptor corepressor.
16141343 2005 Estrogen down-regulation of the corepressor N-CoR: mechanism and implications for estrogen derepression of N-CoR-regulated genes.
16024779 2005 JMJD2A is a novel N-CoR-interacting protein and is involved in repression of the human transcription factor achaete scute-like homologue 2 (ASCL2/Hash2).
15878880 2005 Transcriptional activity of Sp1 is regulated by molecular interactions between the zinc finger DNA binding domain and the inhibitory domain with corepressors, and this interaction is modulated by MEK.
15802375 2005 Cell cycle progression stimulated by tamoxifen-bound estrogen receptor-alpha and promoter-specific effects in breast cancer cells deficient in N-CoR and SMRT.
15788656 2005 Associations and interactions between Ets-1 and Ets-2 and coregulatory proteins, SRC-1, AIB1, and NCoR in breast cancer.
15761026 2005 The orphan nuclear receptor Rev-erbalpha recruits the N-CoR/histone deacetylase 3 corepressor to regulate the circadian Bmal1 gene.
15695367 2005 The nuclear receptor corepressor deacetylase activating domain is essential for repression by thyroid hormone receptor.
15598662 2005 The androgen receptor recruits nuclear receptor CoRepressor (N-CoR) in the presence of mifepristone via its N and C termini revealing a novel molecular mechanism for androgen receptor antagonists.
15561719 2005 Human THAP7 is a chromatin-associated, histone tail-binding protein that represses transcription via recruitment of HDAC3 and nuclear hormone receptor corepressor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15454082 2004 MTA3 and the Mi-2/NuRD complex regulate cell fate during B lymphocyte differentiation.
15377655 2004 The nuclear receptor co-repressor (N-CoR) utilizes repression domains I and III for interaction and co-repression with ETO.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15001550 2004 Transcriptional cofactors exhibit differential preference toward peroxisome proliferator-activated receptors alpha and delta in uterine cells.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14527417 2003 N-CoR mediates DNA methylation-dependent repression through a methyl CpG binding protein Kaiso.
14525983 2003 DACH1 inhibits transforming growth factor-beta signaling through binding Smad4.
12904255 2003 ERbeta Binds N-CoR in the Presence of Estrogens via an LXXLL-like Motif in the N-CoR C-terminus.
12890497 2003 CHD1 associates with NCoR and histone deacetylase as well as with RNA splicing proteins.
12861000 2003 The N-CoR/histone deacetylase 3 complex is required for repression by thyroid hormone receptor.
12648520 2003 The nuclear receptor corepressor (N-CoR) modulates basal and activated transcription of genes controlled by retinoic acid.
12634383 2003 Epstein-Barr virus nuclear antigen 3C recruits histone deacetylase activity and associates with the corepressors mSin3A and NCoR in human B-cell lines.
12628926 2003 Purification and functional characterization of the human N-CoR complex: the roles of HDAC3, TBL1 and TBLR1.
12590135 2003 The histone deacetylase 9 gene encodes multiple protein isoforms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466959 2002 Prohibitin co-localizes with Rb in the nucleus and recruits N-CoR and HDAC1 for transcriptional repression.
12150997 2002 Exchange of N-CoR corepressor and Tip60 coactivator complexes links gene expression by NF-kappaB and beta-amyloid precursor protein.
12149646 2002 PDCD2 is a negative regulator of HCF-1 (C1).
12145334 2002 Identification of a negative regulatory surface within estrogen receptor alpha provides evidence in support of a role for corepressors in regulating cellular responses to agonists and antagonists.
12089345 2002 Inhibition of the dihydrotestosterone-activated androgen receptor by nuclear receptor corepressor.
12077342 2002 Mammalian PRP4 kinase copurifies and interacts with components of both the U5 snRNP and the N-CoR deacetylase complexes.
12011091 2002 RU486-induced glucocorticoid receptor agonism is controlled by the receptor N terminus and by corepressor binding.
12007404 2002 An induced Ets repressor complex regulates growth arrest during terminal macrophage differentiation.
11997503 2002 The transcription factor B-Myb is maintained in an inhibited state in target cells through its interaction with the nuclear corepressors N-CoR and SMRT.
11931768 2002 The N-CoR-HDAC3 nuclear receptor corepressor complex inhibits the JNK pathway through the integral subunit GPS2.
11903058 2002 Nuclear receptor corepressor-dependent repression of peroxisome-proliferator-activated receptor delta-mediated transactivation.
11877444 2002 T0070907, a selective ligand for peroxisome proliferator-activated receptor gamma, functions as an antagonist of biochemical and cellular activities.
11804585 2002 Enzymatic activity associated with class II HDACs is dependent on a multiprotein complex containing HDAC3 and SMRT/N-CoR.
11748154 2001 Molecular effects of novel mutations in Hesx1/HESX1 associated with human pituitary disorders.
11533236 2001 ETO, a target of t(8;21) in acute leukemia, makes distinct contacts with multiple histone deacetylases and binds mSin3A through its oligomerization domain.
11509652 2001 The SMRT and N-CoR corepressors are activating cofactors for histone deacetylase 3.
11486045 2001 HERP, a novel heterodimer partner of HES/E(spl) in Notch signaling.
11466315 2001 Human HDAC7 histone deacetylase activity is associated with HDAC3 in vivo.
11441023 2001 The Ski protein family is required for MeCP2-mediated transcriptional repression.
11430826 2001 Role of PML and PML-RARalpha in Mad-mediated transcriptional repression.
11331609 2001 Sharp, an inducible cofactor that integrates nuclear receptor repression and activation.
11113190 2001 Oligomerization of ETO is obligatory for corepressor interaction.
11013263 2000 A novel nuclear receptor corepressor complex, N-CoR, contains components of the mammalian SWI/SNF complex and the corepressor KAP-1.
10944117 2000 Both corepressor proteins SMRT and N-CoR exist in large protein complexes containing HDAC3.
10940306 2000 Characterization of the repressor function of the nuclear orphan receptor retinoid receptor-related testis-associated receptor/germ cell nuclear factor.
10898795 2000 BCoR, a novel corepressor involved in BCL-6 repression.
10882117 2000 Oligomerization of RAR and AML1 transcription factors as a novel mechanism of oncogenic activation.
10734313 2000 The adenovirus E1A binding protein BS69 is a corepressor of transcription through recruitment of N-CoR.
10640275 2000 Nuclear receptor corepressors partner with class II histone deacetylases in a Sin3-independent repression pathway.
10573424 1999 The CoRNR motif controls the recruitment of corepressors by nuclear hormone receptors.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10444336 1999 Localization of the human nuclear receptor corepressor (hN-CoR) gene between the CMT1A and the SMS critical regions of chromosome 17p11.2.
10441327 1999 Aberrant interactions of transcriptional repressor proteins with the Huntington's disease gene product, huntingtin.
10441075 1999 Retinoid receptors in health and disease: co-regulators and the chromatin connection.
10336495 1999 Identification of nuclear receptor corepressor as a peroxisome proliferator-activated receptor alpha interacting protein.
10077563 1999 Unique forms of human and mouse nuclear receptor corepressor SMRT.
10049357 1999 Ski is a component of the histone deacetylase complex required for transcriptional repression by Mad and thyroid hormone receptor.
9724795 1998 ETO, fusion partner in t(8;21) acute myeloid leukemia, represses transcription by interaction with the human N-CoR/mSin3/HDAC1 complex.
9702189 1998 SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors.
9694793 1998 A histone deacetylase corepressor complex regulates the Notch signal transduction pathway.
9531570 1998 Reduced retinoic acid-sensitivities of nuclear receptor corepressor binding to PML- and PLZF-RARalpha underlie molecular pathogenesis and treatment of acute promyelocytic leukemia.
9482666 1998 Identification and characterization of a novel corepressor interaction region in RVR and Rev-erbA alpha.
9405624 1997 Cloning and characterization of a corepressor and potential component of the nuclear hormone receptor repression complex.
9328355 1997 Transcriptional activation and repression by RORalpha, an orphan nuclear receptor required for cerebellar development.
9111334 1997 Nuclear receptor corepressors activate rather than suppress basal transcription of genes that are negatively regulated by thyroid hormone.
8948627 1996 Two receptor interaction domains in the corepressor, N-CoR/RIP13, are required for an efficient interaction with Rev-erbA alpha and RVR: physical association is dependent on the E region of the orphan receptors.