Property Summary

NCBI Gene PubMed Count 45
PubMed Score 66.12
PubTator Score 165.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Endometriosis 535
Disease Target Count P-value
ovarian cancer 8491 2.4e-06
dermatomyositis 966 4.6e-04
lung cancer 4473 1.0e-03
astrocytoma 1493 9.1e-03
intraductal papillary-mucinous neoplasm (IPMN) 3289 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Melanoma 261 0.0 2.0
Disease Target Count Z-score Confidence
Hypertensive retinopathy 9 3.301 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma 1.300 9.1e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.2e-02
lung cancer 1.100 1.0e-03
ovarian cancer 1.800 2.4e-06
dermatomyositis 1.200 4.6e-04

Protein-protein Interaction (5)

Gene RIF (21)

PMID Text
21552418 diverse physiological function of NCOA6 may be mediated by multiple isoforms expressed in different tissues and localized in different subcellular compartments
21292004 NCOA6 is responsible for the synergistic activation of CYP2C9 by HNF4alpha and pregnane X receptor and NCOA6 differentially regulates CYP2C9 and CYP3A4 gene expression though both the genes are regulated by the same nuclear receptors.
20721975 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19556342 ASCOM-MLL3 and ASCOM-MLL4 play redundant but essential roles in FXR transactivation via their histone 3 lysine 4 trimethylation activity.
19329434 Promoter analysis showed that PRIP acted through serum-responsive factor to regulate FOS gene expression.
18854154 Knockdown of nuclear receptor coactivator 6 (NCOA6) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18660489 Observational study of gene-disease association. (HuGE Navigator)
18552123 The coactivator NCOA6 mediates the mechanism of the synergistic activation of the CYP2C9 gene by CAR and HNF4alpha.
18462265 AIB3 contributes to the maintenance of beta-cell function in nondiabetic children and regulates gene expression in INS-1 cells.
18462265 Observational study of gene-disease association. (HuGE Navigator)
18263591 interaction between RAP250, Smad2, and Smad3 constitutes an important bridging mechanism linking LXR and TGF-beta signaling pathways.
18031289 The retinoid x receptor does not interact with the NR box-1 of ASC-2, but functions as an allosteric activator of LXR binding to NR box-2 of ASC-2.
15764585 ASC-2 is a bona fide coactivator of the xenobiotic nuclear receptor CAR and mediate the specific xenobiotic response by CAR in vivo.
14960326 results suggest that ASC-2 is a novel coactivator for HSF1 and heat shock stress may contribute to the strong active transcription complex through sequential recruitment of HSF1 and ASC-2.
14734562 ASC-2 has a role in inducing target gene transcription during granulocytic differentiation through binding to ATF2
14645241 ASC-2 appears to contain at least three distinct nuclear receptor interaction domains; also, Rb and ASC-2 have roles in androgen receptor transactivation
12724417 ASC-2 is a physiologically important transcriptional coactivator of LXRs and demonstrate its pivotal role in the liver lipid metabolism
12519782 interacts with and stimulates its associated DNA-dependent protein kinase
12519782 The activation of DNA-PK in the absence of DNA ends by the coactivator TRBP suggests a novel mechanism of coactivator-stimulated DNA-PK phosphorylation in transcriptional regulation.
12482968 we show that ASC-2 belongs to a steady-state complex of approximately 2 MDa (ASC-2 complex [ASCOM]) in HeLa nuclei. ASCOM contains retinoblastoma-binding protein RBQ-3, alpha/beta-tubulins, and trithorax group proteins ALR-1, ALR-2, HALR, and ASH2.

AA Sequence

MVLDDLPNLEDIYTSLCSSTMEDSEMDFDSGLEDDDTKSDSILEDSTIFVAFKGNIDDKDFKWKLDAILK      1 - 70
NVPNLLHMESSKLKVQKVEPWNSVRVTFNIPREAAERLRILAQSNNQQLRDLGILSVQIEGEGAINLALA     71 - 140
QNRSQDVRMNGPMGAGNSVRMEAGFPMASGPGIIRMNNPATVMIPPGGNVSSSMMAPGPNPELQPRTPRP    141 - 210
ASQSDAMDPLLSGLHIQQQSHPSGSLAPPHHPMQPVSVNRQMNPANFPQLQQQQQQQQQQQQQQQQQQQQ    211 - 280
QQQQQLQARPPQQHQQQQPQGIRPQFTAPTQVPVPPGWNQLPSGALQPPPAQGSLGTMTANQGWKKAPLP    281 - 350
GPMQQQLQARPSLATVQTPSHPPPPYPFGSQQASQAHTNFPQMSNPGQFTAPQMKSLQGGPSRVPTPLQQ    351 - 420
PHLTNKSPASSPSSFQQGSPASSPTVNQTQQQMGPRPPQNNPLPQGFQQPVSSPGRNPMVQQGNVPPNFM    421 - 490
VMQQQPPNQGPQSLHPGLGGMPKRLPPGFSAGQANPNFMQGQVPSTTATTPGNSGAPQLQANQNVQHAGG    491 - 560
QGAGPPQNQMQVSHGPPNMMQPSLMGIHGNMNNQQAGTSGVPQVNLSNMQGQPQQGPPSQLMGMHQQIVP    561 - 630
SQGQMVQQQGTLNPQNPMILSRAQLMPQGQMMVNPPSQNLGPSPQRMTPPKQMLSQQGPQMMAPHNQMMG    631 - 700
PQGQVLLQQNPMIEQIMTNQMQGNKQQFNTQNQSNVMPGPAQIMRGPTPNMQGNMVQFTGQMSGQMLPQQ    701 - 770
GPVNNSPSQVMGIQGQVLRPPGPSPHMAQQHGDPATTANNDVSLSQMMPDVSIQQTNMVPPHVQAMQGNS    771 - 840
ASGNHFSGHGMSFNAPFSGAPNGNQMSCGQNPGFPVNKDVTLTSPLLVNLLQSDISAGHFGVNNKQNNTN    841 - 910
ANKPKKKKPPRKKKNSQQDLNTPDTRPAGLEEADQPPLPGEQGINLDNSGPKLPEFSNRPPGYPSQPVEQ    911 - 980
RPLQQMPPQLMQHVAPPPQPPQQQPQPQLPQQQQPPPPSQPQSQQQQQQQQQMMMMLMMQQDPKSVRLPV    981 - 1050
SQNVHPPRGPLNPDSQRMPMQQSGSVPVMVSLQGPASVPPSPDKQRMPMPVNTPLGSNSRKMVYQESPQN   1051 - 1120
PSSSPLAEMASLPEASGSEAPSVPGGPNNMPSHVVLPQNQLMMTGPKPGPSPLSATQGATPQQPPVNSLP   1121 - 1190
SSHGHHFPNVAAPTQTSRPKTPNRASPRPYYPQTPNNRPPSTEPSEISLSPERLNASIAGLFPPQINIPL   1191 - 1260
PPRPNLNRGFDQQGLNPTTLKAIGQAPSNLTMNPSNFATPQTHKLDSVVVNSGKQSNSGATKRASPSNSR   1261 - 1330
RSSPGSSRKTTPSPGRQNSKAPKLTLASQTNAALLQNVELPRNVLVSPTPLANPPVPGSFPNNSGLNPQN   1331 - 1400
STVSVAAVGGVVEDNKESLNVPQDSDCQNSQSRKEQVNIELKAVPAQEVKMVVPEDQSKKDGQPSDPNKL   1401 - 1470
PSVEENKNLVSPAMREAPTSLSQLLDNSGAPNVTIKPPGLTDLEVTPPVVSGEDLKKASVIPTLQDLSSS   1471 - 1540
KEPSNSLNLPHSNELCSSLVHPELSEVSSNVAPSIPPVMSRPVSSSSISTPLPPNQITVFVTSNPITTSA   1541 - 1610
NTSAALPTHLQSALMSTVVTMPNAGSKVMVSEGQSAAQSNARPQFITPVFINSSSIIQVMKGSQPSTIPA   1611 - 1680
APLTTNSGLMPPSVAVVGPLHIPQNIKFSSAPVPPNALSSSPAPNIQTGRPLVLSSRATPVQLPSPPCTS   1681 - 1750
SPVVPSHPPVQQVKELNPDEASPQVNTSADQNTLPSSQSTTMVSPLLTNSPGSSGNRRSPVSSSKGKGKV   1751 - 1820
DKIGQILLTKACKKVTGSLEKGEEQYGADGETEGQGLDTTAPGLMGTEQLSTELDSKTPTPPAPTLLKMT   1821 - 1890
SSPVGPGTASAGPSLPGGALPTSVRSIVTTLVPSELISAVPTTKSNHGGIASESLAGGLVEEKVGSHPEL   1891 - 1960
LPSIAPSQNLVSKETSTTALQASVARPELEVNAAIVSGQSSEPKEIVEKSKIPGRRNSRTEEPTVASESV   1961 - 2030
ENGHRKRSSRPASASSSTKDITSAVQSKRRKSK                                        2031 - 2063
//

Text Mined References (50)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23870121 2013 SET1 and p300 act synergistically, through coupled histone modifications, in transcriptional activation by p53.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21552418 2011 Identification and characterization of the alternatively spliced nuclear receptor coactivator-6 isoforms.
21292004 2011 NCOA6 differentially regulates the expression of the CYP2C9 and CYP3A4 genes.
20721975 2010 Association of a common AGO1 variant with lung cancer risk: a two-stage case-control study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19556342 2009 ASCOM controls farnesoid X receptor transactivation through its associated histone H3 lysine 4 methyltransferase activity.
19329434 2009 PRIP promotes tumor formation through enhancing serum-responsive factor-mediated FOS expression.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18552123 2008 Nuclear receptor coactivator 6 mediates the synergistic activation of human cytochrome P-450 2C9 by the constitutive androstane receptor and hepatic nuclear factor-4alpha.
18462265 2008 The nuclear receptor coactivator AIB3 is a modulator of HOMA beta-cell function in nondiabetic children.
18263591 2008 RAP250 is a coactivator in the transforming growth factor beta signaling pathway that interacts with Smad2 and Smad3.
18031289 2008 RXR heterodimerization allosterically activates LXR binding to the second NR box of activating signal co-integrator-2.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17925232 2007 The BRCT-domain containing protein PTIP links PAX2 to a histone H3, lysine 4 methyltransferase complex.
17500065 2007 PTIP associates with MLL3- and MLL4-containing histone H3 lysine 4 methyltransferase complex.
17178841 2007 Knockdown of ALR (MLL2) reveals ALR target genes and leads to alterations in cell adhesion and growth.
17021013 2006 Coactivator as a target gene specificity determinant for histone H3 lysine 4 methyltransferases.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15764585 2005 Characterization of activating signal cointegrator-2 as a novel transcriptional coactivator of the xenobiotic nuclear receptor constitutive androstane receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14960326 2004 Coactivator ASC-2 mediates heat shock factor 1-mediated transactivation dependent on heat shock.
14734562 2004 Activation and interaction of ATF2 with the coactivator ASC-2 are responsive for granulocytic differentiation by retinoic acid.
14645241 2004 Interactions between activating signal cointegrator-2 and the tumor suppressor retinoblastoma in androgen receptor transactivation.
12724417 2003 Activating signal cointegrator 2 required for liver lipid metabolism mediated by liver X receptors in mice.
12519782 2003 Nuclear receptor coactivator thyroid hormone receptor-binding protein (TRBP) interacts with and stimulates its associated DNA-dependent protein kinase.
12482968 2003 Activating signal cointegrator 2 belongs to a novel steady-state complex that contains a subset of trithorax group proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12215545 2002 NRC-interacting factor 1 is a novel cotransducer that interacts with and regulates the activity of the nuclear hormone receptor coactivator NRC.
12189208 2002 Identification of a transcriptionally active peroxisome proliferator-activated receptor alpha -interacting cofactor complex in rat liver and characterization of PRIC285 as a coactivator.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12039952 2002 Identification of protein arginine methyltransferase 2 as a coactivator for estrogen receptor alpha.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11773444 2002 Ser-884 adjacent to the LXXLL motif of coactivator TRBP defines selectivity for ERs and TRs.
11704680 2002 Molecular cloning and characterization of CAPER, a novel coactivator of activating protein-1 and estrogen receptors.
11517327 2001 Cloning and characterization of PIMT, a protein with a methyltransferase domain, which interacts with and enhances nuclear receptor coactivator PRIP function.
11443112 2001 Identification and characterization of RRM-containing coactivator activator (CoAA) as TRBP-interacting protein, and its splice variant as a coactivator modulator (CoAM).
11302752 2001 Functional interaction of transcriptional coactivator ASC-2 and C/EBPalpha in granulocyte differentiation of HL-60 promyelocytic cell.
10866662 2000 A new family of nuclear receptor coregulators that integrate nuclear receptor signaling through CREB-binding protein.
10823961 2000 Thyroid hormone receptor-binding protein, an LXXLL motif-containing protein, functions as a general coactivator.
10788465 2000 Isolation and characterization of peroxisome proliferator-activated receptor (PPAR) interacting protein (PRIP) as a coactivator for PPAR.
10681503 2000 Cloning and characterization of RAP250, a novel nuclear receptor coactivator.
10567404 1999 A nuclear factor, ASC-2, as a cancer-amplified transcriptional coactivator essential for ligand-dependent transactivation by nuclear receptors in vivo.
8758910 1996 Hybrid selection of transcribed sequences from microdissected DNA: isolation of genes within amplified region at 20q11-q13.2 in breast cancer.
8724849 1996 Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1.
8263591 Evaluation of a patient information booklet.
7536696 1995 Random rapid amplification of cDNA ends (RRACE) allows for cloning of multiple novel human cDNA fragments containing (CAG)n repeats.