Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.89
PubTator Score 154.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.189 4.4e-06
group 4 medulloblastoma 1.600 8.8e-06
atypical teratoid / rhabdoid tumor 1.100 1.7e-05
medulloblastoma, large-cell 1.500 6.2e-06

Gene RIF (4)

PMID Text
25416054 NCOA5 low expression correlates with survival in esophageal squamous cell carcinoma.
24332041 suggest that NCOA5 is a haploinsufficient tumor suppressor and that NCOA5 deficiency increases susceptibility to both glucose intolerance and HCC, partially by increasing IL-6 expression
21645569 gene polymorphism confers susceptibility to psoriasis in a Southern European population
20650312 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MNTAPSRPSPTRRDPYGFGDSRDSRRDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDLRDHRHSRDLR      1 - 70
DHRDSRSVRDVRDVRDLRDFRDLRDSRDFRDQRDPMYDRYRDMRDSRDPMYRREGSYDRYLRMDDYCRRK     71 - 140
DDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTK    141 - 210
DYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRN    211 - 280
MPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLA    281 - 350
DNRYLTAEETDKIINYLRERKERLMRSSTDSLPGPISRQPLGATSGASLKTQPSSQPLQSGQVLPSATPT    351 - 420
PSAPPTSQQELQAKILSLFNSGTVTANSSSASPSVAAGNTPNQNFSTAANSQPQQRSQASGNQPPSILGQ    421 - 490
GGSAQNMGPRPGAPSQGLFGQPSSRLAPASNMTSQRPVSSTGINFDNPSVQKALDTLIQSGPALSHLVSQ    491 - 560
TTAQMGQPQAPMGSYQRHY                                                       561 - 579
//

Text Mined References (26)

PMID Year Title
25416054 2014 NCOA5 low expression correlates with survival in esophageal squamous cell carcinoma.
24332041 2013 NCOA5 haploinsufficiency results in glucose intolerance and subsequent hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21645569 2011 A CD40 and an NCOA5 gene polymorphism confer susceptibility to psoriasis in a Southern European population: a case-control study.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20650312 2010 Analysis of candidate genes on chromosome 20q12-13.1 reveals evidence for BMI mediated association of PREX1 with type 2 diabetes in European Americans.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17890166 2007 The nuclear PP1 interacting protein ZAP3 (ZAP) is a putative nucleoside kinase that complexes with SAM68, CIA, NF110/45, and HNRNP-G.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15073177 2004 TIP30 interacts with an estrogen receptor alpha-interacting coactivator CIA and regulates c-myc transcription.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11113208 2001 CIA, a novel estrogen receptor coactivator with a bifunctional nuclear receptor interacting determinant.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.