Property Summary

NCBI Gene PubMed Count 55
PubMed Score 127.86
PubTator Score 107.29

Knowledge Summary

Patent

No data available

Gene RIF (31)

PMID Text
26436293 Ubiquitin-dependent NCOA4 turnover is promoted by excess iron and involves an iron-dependent interaction between NCOA4 and the HERC2 ubiquitin ligase.
25327288 provide a new mechanism for selective autophagy of ferritin and reveal a previously unappreciated role for autophagy and NCOA4 in the control of iron homeostasis in vivo
24957039 RET/PTC3 gene rearrangements are the most prevalent form of rearrangements in papillary thyroid carcinomas of Chennai population.
24910095 NCOA4 acts as a regulator of DNA replication origins that helps prevent inappropriate DNA synthesis and replication stress.
24695223 identification of NCOA4 as a selective cargo receptor for autophagic turnover of ferritin (ferritinophagy), which is critical for iron homeostasis, and provides a resource for further dissection of autophagosomal cargo-receptor connectivity
24122203 mechanism dissection shows that KLK2 may cooperate with the AR coregulator, ARA70, to enhance AR transactivation that may result in alteration of prostate cancer formation
22887727 Data indicate that the increase in prostate cancer (PC) risk associated with rs10993994:C>T is likely mediated by the variant's effect of MSMB-encoded protein PSP94 expression; however, this effect does not extend to NCOA4 in the data.
22661295 Computational network analysis reveals that the MSMB gene is functionally connected to NCOA4 and the androgen receptor signaling pathway. The data provide an example of how GWAS-associated variants may have multiple genetic and epigenetic effects
22562579 Studies indicate nuclear receptor coactivator 4 (NcoA4) as a coactivator for a variety of nuclear receptors.
21085629 Suppression of MSMB expression or NCOA4 overexpression promotes anchorage-independent growth of prostate epithelial cells.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20717903 Observational study of gene-disease association. (HuGE Navigator)
20167864 ARA70alpha functions as a tumor suppressor gene
20012784 Screening for BRAF, RET, KRAS, NRAS, and HRAS mutations, as well as RET-PTC1 and RET-PTC3 rearrangements, was performed on cases of Hashimoto thyroiditis with a dominant nodule
19730683 Observational study of gene-disease association. (HuGE Navigator)
19487296 PTC1 and PTC3 are highly oncogenic proteins when overexpressed, but result in indolent disease compared with RET-related MTCs due to their relatively low expression from the NCOA4 and CCDC6 promoters in vivo.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18156210 ARA70 beta is a regulator of tumor cell growth and metastasis by affecting gene expression
18091327 in prostate cancer cell lines, ARA70beta localized to the cytosol, whereas ARA70alpha was found in the nucleus, supporting the notion of their dissimilar functions
17919607 Expression of androgen receptor co-regulators in the testes of men with azoospermia.
16762319 a functional interaction between NcoA4 and AhR that may alter AhR activity to affect disease development and progression is demonstrated
16385451 Observational study of gene-disease association. (HuGE Navigator)
15805579 Together, ARA54 and ARA70 modulate vitamin D receptor transactivation, and the competition for ARA70 mediates the suppressive affect of androgen-androgen receptor on vitamin D receptor transactivation.
15772083 ARA70 is a coactivator for estrogen receptor alpha (ERalpha) and may represent a functional link between ERalpha/androgen receptor (AR) modulating their cross-talk in models of estrogen signaling in MCF-7 and HeLa cells
15642480 The refolding and one-step purification of ARA70 from inclusion bodies over-expressed in Escherichia coli is reported.
12897377 ARA70 was identifed as a coactivator of PPARalpha in the prostate cancer cell line DU145. In the adrenal cell line Y1, ARA70 behaved as a repressor of PPARalpha while still able to coactivate PPARgamma.
12881713 causes increases in nuclear NF-kappaB activity and secretion of MCP-1 and GM-CSF; studies implicate oncogene-induced cytokine-signaling pathways in a new mechanism linking inflammation with cancer
12649293 role in reducing agonist activity of antiandrogens
12068007 ARA70 has a role in enhancing the androgen receptor during testicular development
11818501 Domain interactions between coregulator ARA(70) and the androgen receptor (AR); structure activity relationship
11786418 Potent mitogenicity of the RET/PTC3 oncogene correlates with its prevalence in tall-cell variant of papillary thyroid carcinoma.

AA Sequence

MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWL      1 - 70
YEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLF     71 - 140
EADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKP    141 - 210
ASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSS    211 - 280
FSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNC    281 - 350
QGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDE    351 - 420
NCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPSRIADSFQVIK    421 - 490
NSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWL    491 - 560
LRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM                    561 - 614
//

Text Mined References (58)

PMID Year Title
26436293 2015 Ferritinophagy via NCOA4 is required for erythropoiesis and is regulated by iron dependent HERC2-mediated proteolysis.
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
24957039 2014 Prevalence of RET/PTC1 and RET/PTC3 gene rearrangements in Chennai population and its correlation with clinical parameters.
24910095 2014 NCOA4 transcriptional coactivator inhibits activation of DNA replication origins.
24695223 2014 Quantitative proteomics identifies NCOA4 as the cargo receptor mediating ferritinophagy.
24122203 2014 Human kallikrein 2 (KLK2) promotes prostate cancer cell growth via function as a modulator to promote the ARA70-enhanced androgen receptor transactivation.
22887727 2013 Investigation of the relationship between prostate cancer and MSMB and NCOA4 genetic variants and protein expression.
22661295 2012 Promoter variants in the MSMB gene associated with prostate cancer regulate MSMB/NCOA4 fusion transcripts.
22562579 2012 Expression and function of nuclear receptor co-activator 4: evidence of a potential role independent of co-activator activity.
21085629 2010 Analysis of the 10q11 cancer risk locus implicates MSMB and NCOA4 in human prostate tumorigenesis.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20717903 2011 Evidence for an association between prostate cancer and chromosome 8q24 and 10q11 genetic variants in African American men: the Flint Men's Health Study.
20167864 2010 Tumor suppressor function of androgen receptor coactivator ARA70alpha in prostate cancer.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20012784 2010 Absence of BRAF, NRAS, KRAS, HRAS mutations, and RET/PTC gene rearrangements distinguishes dominant nodules in Hashimoto thyroiditis from papillary thyroid carcinomas.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19487296 2009 Transcript level modulates the inherent oncogenicity of RET/PTC oncoproteins.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18156210 2008 Stimulation of prostate cancer cellular proliferation and invasion by the androgen receptor co-activator ARA70.
18091327 2008 Androgen receptor coactivator ARA70alpha and ARA70beta isoform-specific antibodies: new tools for studies of expression and immunohistochemical localization.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17919607 2008 Expression of androgen receptor co-regulators in the testes of men with azoospermia.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16762319 2006 Functional interaction of nuclear receptor coactivator 4 with aryl hydrocarbon receptor.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15805579 2005 Androgen-receptor coregulators mediate the suppressive effect of androgen signals on vitamin D receptor activity.
15772083 2005 Endogenous coactivator ARA70 interacts with estrogen receptor alpha (ERalpha) and modulates the functional ERalpha/androgen receptor interplay in MCF-7 cells.
15642480 2005 Refolding and one-step purification of recombinant human ARA70 over-expressed in Escherichia coli.
15609325 2005 Identification and validation of novel ERBB2 (HER2, NEU) targets including genes involved in angiogenesis.
15572661 2004 Negative modulation of androgen receptor transcriptional activity by Daxx.
15563469 2005 The molecular mechanisms of coactivator utilization in ligand-dependent transactivation by the androgen receptor.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12897377 2003 Induction and repression of peroxisome proliferator-activated receptor alpha transcription by coregulator ARA70.
12881713 2003 Tyrosine kinase oncoprotein, RET/PTC3, induces the secretion of myeloid growth and chemotactic factors.
12649293 2003 Reducing the agonist activity of antiandrogens by a dominant-negative androgen receptor coregulator ARA70 in prostate cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12068007 2002 Mutations in the helix 3 region of the androgen receptor abrogate ARA70 promotion of 17beta-estradiol-induced androgen receptor transactivation.
11818501 2002 Domain interactions between coregulator ARA(70) and the androgen receptor (AR).
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10517667 1999 RFG (ARA70, ELE1) interacts with the human androgen receptor in a ligand-dependent fashion, but functions only weakly as a coactivator in cotransfection assays.
10347167 1999 Identification of ARA70 as a ligand-enhanced coactivator for the peroxisome proliferator-activated receptor gamma.
10085091 1999 Cloning and characterization of human prostate coactivator ARA54, a novel protein that associates with the androgen receptor.
9892017 1999 Interaction of the putative androgen receptor-specific coactivator ARA70/ELE1alpha with multiple steroid receptors and identification of an internally deleted ELE1beta isoform.
9192845 1997 Comparison of the breakpoint regions of ELE1 and RET genes involved in the generation of RET/PTC3 oncogene in sporadic and in radiation-associated papillary thyroid carcinomas.
8643607 1996 Cloning and characterization of a specific coactivator, ARA70, for the androgen receptor in human prostate cells.
8290261 1994 Molecular characterization of RET/PTC3; a novel rearranged version of the RETproto-oncogene in a human thyroid papillary carcinoma.
8187085 1994 Frequent activation of ret protooncogene by fusion with a new activating gene in papillary thyroid carcinomas.
8180971 1994 Development of a single-step duplex RT-PCR detecting different forms of ret activation, and identification of the third form of in vivo ret activation in human papillary thyroid carcinoma.
7529046 1994 The two genes generating RET/PTC3 are localized in chromosomal band 10q11.2.