Property Summary

NCBI Gene PubMed Count 168
PubMed Score 231.03
PubTator Score 172.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis -1.500 3.3e-04
osteosarcoma -1.922 4.3e-04
astrocytoma 1.200 3.5e-02
atypical teratoid / rhabdoid tumor -1.900 9.4e-07
glioblastoma -1.200 1.4e-03
medulloblastoma, large-cell -2.100 1.4e-05
acute quadriplegic myopathy 1.364 7.0e-06
adult high grade glioma -1.200 3.4e-05
aldosterone-producing adenoma -1.026 1.7e-02
invasive ductal carcinoma -1.049 1.0e-04
Breast cancer -1.100 3.4e-09
ovarian cancer -2.100 3.5e-08

Synonym

Accession Q15788 O00150 O43792 O43793 Q13071 Q13420 Q2T9G5 Q53SX3 Q6GVI5 Q7KYV3 NCoA-1
Symbols SRC1
KAT13A
RIP160
F-SRC-1
bHLHe42
bHLHe74

Gene

PDB

3BEJ   3DCT   3DCU   3FXV   3HC5   3HC6   3OKH   3OKI   3OLF   3OMK   3OMM   3OOF   3OOK   3P88   3P89   3RUT   3RUU   3RVF   3UU7   3UUA   3UUD   4MG5   4MG6   4MG7   4MG8   4MG9   4MGA   4MGB   4MGC   4MGD   4TUZ   4TV1   1XV9   1XVP   1PZL   1KV6   1TFC   1FM6   1FM9   1K74   1RDT   2FVJ   2GTK   2HFP   2PRG   3CWD   3ET3   3FEJ   3FUR   3G9E   3H0A   3LMP   3QT0   3S9S   3T03   3V9Y   3VN2   4F9M   4FGY   4HEE   4Y29   5DV6   5DWL   1K7L   2NPA   2P54   3ET1   3FEI   3G8I   5AZT   1NRL   3CTB   3HVL   4J5X   5A86   3KMR   4DQM   4DM6   4DM8   4JYG   4JYH   4JYI   1U3R   1U3S   1X76   1X78   1X7B   1X7J   1YY4   1YYE   1ZAF   2NV7   3OLL   3OLS   3OMO   3OMP   3OMQ   2A3I   4UDA   4UDB   1P8D   4DK7   4DK8   3BQD   1K4W   1N4H   1NQ7   1XIU   2C52   2HBH   2HC4   2HCD   3DR1   3GYT   3GYU   3IPQ   3IPS   3IPU   4G1D   4G1Y   4G1Z   4G20   4G21   4G2H   4RUJ   4RUP   5AVI   5AVL   5DVC   5E7V   5HJS  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (9)

MLP Assay (13)

AID Type Active / Inconclusive / Inactive Description
631 screening 811 / 0 / 195445 Primary biochemical High Throughput Screening assay for agonists of the steroid receptor coactivator 1 (SRC-1) recruitment by the peroxisome proliferator-activated receptor gamma (PPARgamma)
1051 other 335 / 0 / 99032 Measurement of TR-FRET detection format artefact in the screen for agonists of steroid receptor coactivator 1 (SRC-1) recruitment by the peroxisome proliferator-activated receptor gamma (PPARgamma)
1300 screening 340 / 0 / 454 Confirmation biochemical High Throughput Screening assay for agonists of the steroid receptor coactivator 1 (SRC-1) recruitment by the peroxisome proliferator-activated receptor gamma (PPARgamma)
1319 confirmatory 10 / 0 / 339 Dose response biochemical High Throughput Screening assay for agonists of the steroid receptor coactivator 1 (SRC-1) recruitment by the peroxisome proliferator-activated receptor gamma (PPARgamma)
1679 confirmatory 75 / 0 / 325 TR-FRET dose response biochemical High Throughput Screening assay for agonists of the steroid receptor coactivator 1 (SRC-1) recruitment by the peroxisome proliferator-activated receptor gamma (PPAR gamma): non-selective agonists
1808 summary 0 / 0 / 0 Summary of probe development efforts to identify agonists of the steroid receptor coactivator 1 (SRC-1) recruitment by the peroxisome proliferator-activated receptor gamma (PPAR gamma)
588354 screening 428 / 0 / 359055 Luminescence-based cell-based primary high throughput screening assay to identify inhibitors of the Steroid Receptor Coactivator 1 (SRC1; NCOA1)
588362 summary 0 / 0 / 0 Summary of the probe development efforts to identify inhibitors of the Steroid Receptor Coactivator 1 (SRC1; NCOA1)
588820 screening 486 / 0 / 1837 Luminescence-based cell-based high throughput confirmation assay for inhibitors of the Steroid Receptor Coactivator 1 (SRC1; NCOA1).
602168 confirmatory 45 / 0 / 184 Counterscreen for inhibitors of the Steroid Receptor Coactivator 3 (SRC3; NCOA3): Luminescence-based cell-based high throughput dose response assay to identify inhibitors of the Steroid Receptor Coactivator 1 (SRC1; NCOA1)
More...

Gene RIF (73)

PMID Text
26469385 HIV-1 MA upregulates NCOA1 gene expression in HepG2 cells
26371783 Report novel PAX3-NCOA1 gene fusions in biphenotypic sinonasal sarcomas with focal rhabdomyoblastic differentiation.
26287601 NCOA1 potentiates breast cancer angiogenesis through upregulating HIF1alpha and AP-1-mediated VEGFa expression
26267537 Data suggest that over-stimulating the steroid seceptor coactivators SRC-1, SRC-2, and SRC-3 oncogenic program can be an effective strategy to kill cancer cells.
26203193 Data indicate that finerenone inhibits mineralocorticoid receptor (MR), steroid receptor coactivator-1 binding at the regulatory sequence.
26066330 miR-137 has a role in targeting p160 steroid receptor coactivators SRC1, SRC2, and SRC3 and inhibits cell proliferation
25053412 Data show that disrupting the steroid receptor coactivator-1 (SRC1) binding site on retinoid X receptor alpha (RXRalpha) alters the transactivation by CAR:RXR.
24875297 Our study clearly demonstrated differentiation-dependant expression of SRC-1 and SRC-3 in chondrosarcoma
24769444 In a cohort of 453 human breast tumors, NCOA1 and CSF1 levels correlated positively with disease recurrence, higher tumor grade, and poor prognosis.
24719557 SRC1 and Twist1 expression are associated with poor survival in breast cancer.
24652666 SRC-1 polymorphisms may be the underlying cause of coronary artery aneurysms in children with Kawasaki disease.
24648347 Elucidation of how SRC-1 controls transcription in breast cancers.
24586072 NCOA1 plays a necessary role in E2-induced CXCL12 expression and NCOA2 is required for P4 to inhibit the E2-induced CXCL12 production in normal and ectopic endometrium.
24438340 SRC-1 responds to cellular energy stress in tumor cells to promote the expression of genes responsible for oxidative phosphorylation.
24189439 IL-6 secreted by ovarian cancer cells may contribute to the refractoriness of these cells to tamoxifen via the estrogen receptor alpha isoform and SRC-1 (NCOA1).
22371500 Our data demonstrate that SIP is a novel regulator in caspase-independent and AIF-mediated apoptosis.
22328528 Binding of the ERalpha and ARNT1 AF2 domains to exon 21 of the SRC1 isoform SRC1e is essential for estrogen- and dioxin-transcription.
22174377 We have identified a functional genetic variant of SRC-1 with decreased activity, resulting, at least in part, from the loss of a GSK3beta phosphorylation site, which was also associated with decreased bone mineral density in tamoxifen-treated women.
22142990 Results demonstrate that estradiol induces growth of human astrocytoma cell lines through ERalpha and its interaction with SRC-1 and SRC-3 and also suggest differential roles of ERalpha on cell growth depending on astrocytoma grade.
22072566 findings suggest that SRC-1 switches steroid-responsive tumors to a steroid-resistant state in which the SRC-1 target gene ADAM22 has a critical role
21760925 The induced AF1 conformation facilitates its interaction with SRC-1, and subsequent AF1-mediated transcriptional activity.
21059860 Distinctive functions of p160 steroid receptor coactivators in proliferation of an estrogen-independent, tamoxifen-resistant breast cancer cell line.
20682316 NR box-2 and -3 are the essential binding targets for the SRC-1-induced stimulation of LXR transactivity; the competitive in vitro binding of NR box-2 and -3 to LXR was observed.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20145129 HOXC11 and SRC-1 cooperate to regulate expression of the calcium-binding protein S100beta in resistant breast cancer cells.
20003447 Observational study of gene-disease association. (HuGE Navigator)
19953635 Studies expand knowledge of PAX3 variant translocations in rhabdomyossarcoma with identification of a novel PAX3-NCOA2 fusion.
19934375 Clomiphene citrate may inhibit E2-induced endometrial epithelial cell proliferation and ERE transactivation by inhibiting the recruitment of SRC-1 to ER alpha.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19763509 describes in detail the BRET(2) assay as it is used to examine the physical interaction between the nuclear receptor ERalpha and the transcriptional coactivator SRC-1
19485965 Age-induced loss of PPARgamma/SRC-1 interactions increased the binding of PPARgamma to the promoter of the adipogenic gene aP2.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19276281 SRC-1 is a strong independent predictor of reduced disease free survival, whereas the interactions of the p160 proteins with estrogen receptor alpha can predict the response of patients to endocrine treatment.
19255064 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19203349 STAT3 transactivates its target genes by the recruitment of CBP/p300 co-activators and this process generally does not require the contribution of SRC-1.
19183483 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19095746 The small interfering RNA depletion of SRC-1 did not inhibited growth of MCF-7 cells as well as a reduction in ERalpha transcriptional activity.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18845648 important role for androgen receptor-associated coactivators in urothelial carcinoma of the bladder
18660489 Observational study of gene-disease association. (HuGE Navigator)
18284209 The main transactivation function of the androgen receptor interacts with both the C-terminal domain of coactivator SRC-1a and the general transcription factor RAP74/TFIIF large subunit.
17919607 Expression of androgen receptor co-regulators in the testes of men with azoospermia.
17429319 not only the Q158K variant found in Chinese, but also in native pregnane X receptor variants in other ethnic groups (D163G, A370T, R381W, and I403V) affect CYP3A4 induction by altering steroid receptor coactivator-1 recruitment
17135255 Binding and dissociation of full-length steroid receptor coactivator-1a (SRC1a) from full-length estrogen receptor alpha or beta.
16882880 These results establish the importance of coactivators PGC1alpha and SRC1 for the hepatic expression of human P450s and uncover a new HNF4alpha-dependent regulatory mechanism to constitutively control the CYP1A1/2 cluster.
16775354 HPV E7 proteins dysregulate hormone-dependent gene expression by association with and relocalization of SRC-1.
16723356 SRC1-deficient P19 cells showed severely compromised retinoid-induced responses, in agreement with the supposed role of SRC1 as a retinoic acid recepetor coactivator.
16606617 ASXL1 is a novel coactivator of RAR that cooperates with SRC-1
16269961 Observational study of gene-disease association. (HuGE Navigator)
15862975 SRC-1 and SMRT content change in a tissue-specific manner in the rat brain during the estrous cycle.
15661163 HIV-1 MA upregulates NCOA1 gene expression in HepG2 cells
15615775 The SRC-1 has been shown to be involved in HIF-1alpha-mediated activation of transcription.
15530426 The conserved STAT3 region from 752 to 761, called STAT3 CR2, plays critical roles in STAT3-dependent transcription by recruiting SRC-1 and allowing Ser727 phosphorylation.
15456935 Data show that steroid receptor coactivator-1 (SRC-1) overexpressing cells are more responsive to Po mRNA induction by dihydroprogesterone (DHP) than SRC-1-deficient cells, and that DHP treatment increases not only Po but also SRC-1 mRNA levels.
15313887 A novel translocation t(2;2)(q35;p23), which generates a fusion protein composed of PAX3 and the NCOA1was identified in rhabdomyosarcoma.
15231721 TNF-alpha impairs progesterone-stimulated PR-B-mediated transactivation, and these effects appear to be due, in part, to reduced expression of SRC-1 and -2
14757047 surface complementarity between the hydrophobic faces of the STAT6 fragment and of the NCoA-1 PAS-B domain almost exclusively defines the binding specificity between the two proteins
14715875 differential recruitment of steroid receptor coactivator-1 and silencing mediator for retinoid and thyroid receptors by estrogen receptor-alpha and beta in breast cancer may be central to the response of the tumor to endocrine treatment
12954634 NCoA-1/SRC-1 is an essential coactivator of STAT5 that binds to the FDL motif in the alpha-helical region of the STAT5 transactivation domain
12933903 is a coactivator of MHC class II genes that stimulates their interferon gamma (IFNgamma) and class II transactivator (CIITA)-mediated expression.
12529333 Sumoylation was shown to increase progesterone receptor-SRC-1 interaction and to prolong SRC-1 retention in the nucleus.
12482985 our results indicate an important role for Mediator, as well as its functional interplay with p300/CBP-SRC, in the enhancement of ERalpha-dependent transcription with chromatin templates
12403846 Overexpression of SRC-1 (NCOA1) and TIF-2 (NCOA2) increases estrogen-induced gene expression.
12208951 HIV-1 MA upregulates NCOA1 gene expression in HepG2 cells
12163482 Data show that steroid receptor coactivator-1 (SRC-1) enhanced ligand-independent activation of the AR by IL-6 to the same magnitude as that obtained via ligand-dependent activation, and that activation required MAPK.
12138096 STAT6 has a protein binding motif that controls the interaction with NcoA-1 in transcriptional activation
12118039 mutation of the AF2 transactivation domain on Glucocorticoid Receptors disrupts the direct interaction of GR with steroid receptor coactivator 1 (SRC-1)
12114525 CAR antagonizes ER-mediated transcriptional activity by squelching limiting amounts of p160 coactivators, such as SRC-1 and GRIP-1.
11818499 Reduction of coactivator expression by antisense oligodeoxynucleotides inhibits ERalpha transcriptional activity and MCF-7 proliferation
11773079 CBP/p300 and NcoA/SRC1a may function in a common pathway to regulate STAT3 transcriptional activity.
11704662 HIV-1 MA upregulates NCOA1 gene expression in HepG2 cells
9874563 HIV-1 MA upregulates NCOA1 gene expression in HepG2 cells

AA Sequence

MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSLSVKPDKCKIL      1 - 70
KKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEALDGFFFVVNCEGRIVFVSENV     71 - 140
TSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNGVPWPQEATRRNSHTFNCRMLIHPPDEPGTE    141 - 210
NQEACQRYEVMQCFTVSQPKSIQEDGEDFQSCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSL    211 - 280
RAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQ    281 - 350
SPDMQPFIMGIHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINR    351 - 420
QQSSDLHSSSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTGISLAQFMSPR    421 - 490
RQVTSGLATRPRMPNNSFPPNISTLSSPVGMTSSACNNNNRSYSNIPVTSLQGMNEGPNNSVGFSASSPV    491 - 560
LRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDNSSSDGKPLDSGLLHNNDRLSDGDSKYSQTS    561 - 630
HKLVQLLTTTAEQQLRHADIDTSCKDVLSCTGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPS    631 - 700
DITTLSVEPDKKDSASTSVSVTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDD    701 - 770
VKVKVEKKEQMDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAV    771 - 840
TSVTIKSEILPASLQSATARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAINQSKSEDQCIS    841 - 910
SQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKLVQGGGLDVLSERFPPQQATP    911 - 980
PLIMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLGTMPVQVTPPRGAFSPGMGMQPRQTLNRPPAA    981 - 1050
PNQLRLQLQQRLQGQQQLIHQNRQAILNQFAATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQ   1051 - 1120
HRQRQLIQQQRAMLMRQQSFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQL   1121 - 1190
AANPEASLANRNSMVSRGMTGNIGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPI   1191 - 1260
PPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVSMAGGNTNVQN   1261 - 1330
MNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTEADGTQQVQQVQVFADVQCTV   1331 - 1400
NLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE                                1401 - 1441
//

Text Mined References (177)

PMID Year Title
26371783 2016 Novel PAX3-NCOA1 Fusions in Biphenotypic Sinonasal Sarcoma With Focal Rhabdomyoblastic Differentiation.
26287601 2015 NCOA1 promotes angiogenesis in breast tumors by simultaneously enhancing both HIF1?- and AP-1-mediated VEGFa transcription.
26267537 2015 Characterization of a Steroid Receptor Coactivator Small Molecule Stimulator that Overstimulates Cancer Cells and Leads to Cell Stress and Death.
26203193 2015 Finerenone Impedes Aldosterone-dependent Nuclear Import of the Mineralocorticoid Receptor and Prevents Genomic Recruitment of Steroid Receptor Coactivator-1.
26066330 2015 miR-137 Targets p160 Steroid Receptor Coactivators SRC1, SRC2, and SRC3 and Inhibits Cell Proliferation.
25962847 2015 Tumor suppressor Menin acts as a corepressor of LXR? to inhibit hepatic lipogenesis.
25261932 2014 Genome-wide association study identifies multiple susceptibility loci for diffuse large B cell lymphoma.
25219498 2014 Modification of ASC1 by UFM1 is crucial for ER? transactivation and breast cancer development.
25053412 2014 Agonist ligands mediate the transcriptional response of nuclear receptor heterodimers through distinct stoichiometric assemblies with coactivators.
24875297 2014 Immunohistochemical localization of steroid receptor coactivators in chondrosarcoma: an in vivo tissue microarray study.
24769444 2014 NCOA1 Directly Targets M-CSF1 Expression to Promote Breast Cancer Metastasis.
24719557 2014 SRC-1 and Twist1 expression positively correlates with a poor prognosis in human breast cancer.
24652666 2014 Association between SRC-1 gene polymorphisms and coronary artery aneurysms formation in Taiwanese children with Kawasaki disease.
24648347 2014 Global gene repression by the steroid receptor coactivator SRC-1 promotes oncogenesis.
24586072 2014 The role of SRC1 and SRC2 in steroid-induced SDF1 expression in normal and ectopic endometrium.
24438340 2014 Steroid receptor coactivator 1 is an integrator of glucose and NAD+/NADH homeostasis.
24189439 2014 Autocrine production of interleukin-6 confers ovarian cancer cells resistance to tamoxifen via ER isoforms and SRC-1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22371500 2012 Steroid receptor coactivator-interacting protein (SIP) inhibits caspase-independent apoptosis by preventing apoptosis-inducing factor (AIF) from being released from mitochondria.
22328528 2012 Binding of the ER? and ARNT1 AF2 domains to exon 21 of the SRC1 isoform SRC1e is essential for estrogen- and dioxin-related transcription.
22174377 2012 A SNP in steroid receptor coactivator-1 disrupts a GSK3? phosphorylation site and is associated with altered tamoxifen response in bone.
22142990 2012 Estradiol increases cell growth in human astrocytoma cell lines through ER? activation and its interaction with SRC-1 and SRC-3 coactivators.
22072566 2012 Global characterization of the SRC-1 transcriptome identifies ADAM22 as an ER-independent mediator of endocrine-resistant breast cancer.
21760925 2011 TBP binding-induced folding of the glucocorticoid receptor AF1 domain facilitates its interaction with steroid receptor coactivator-1.
21454491 2011 Repression of androgen receptor activity by HEYL, a third member of the Hairy/Enhancer-of-split-related family of Notch effectors.
21059860 2011 Distinctive functions of p160 steroid receptor coactivators in proliferation of an estrogen-independent, tamoxifen-resistant breast cancer cell line.
20682316 2010 Molecular determinants of the interactions between SRC-1 and LXR/RXR heterodimers.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20203100 2010 Structural basis for hydroxycholesterols as natural ligands of orphan nuclear receptor RORgamma.
20145129 2010 Interaction of developmental transcription factor HOXC11 with steroid receptor coactivator SRC-1 mediates resistance to endocrine therapy in breast cancer [corrected].
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20047962 2010 Protein arginine methyltransferase 6 regulates multiple aspects of gene expression.
20003447 2009 Nuclear receptor coregulator SNP discovery and impact on breast cancer risk.
19953635 2010 Recurrent t(2;2) and t(2;8) translocations in rhabdomyosarcoma without the canonical PAX-FOXO1 fuse PAX3 to members of the nuclear receptor transcriptional coactivator family.
19934375 2010 Molecular mechanism of the inhibition of estradiol-induced endometrial epithelial cell proliferation by clomiphene citrate.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19786558 2009 The basic helix-loop-helix proteins differentiated embryo chondrocyte (DEC) 1 and DEC2 function as corepressors of retinoid X receptors.
19763509 2009 Detection of ERalpha-SRC-1 interactions using bioluminescent resonance energy transfer.
19485965 2009 Aging alters PPARgamma in rodent and human adipose tissue by modulating the balance in steroid receptor coactivator-1.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19276281 2009 Coassociation of estrogen receptor and p160 proteins predicts resistance to endocrine treatment; SRC-1 is an independent predictor of breast cancer recurrence.
19255064 2009 Vitamin D-related genes, serum vitamin D concentrations and prostate cancer risk.
19203349 2009 Co-activator SRC-1 is dispensable for transcriptional control by STAT3.
19183483 2009 Screening and association testing of common coding variation in steroid hormone receptor co-activator and co-repressor genes in relation to breast cancer risk: the Multiethnic Cohort.
19095746 2009 Unique roles of p160 coactivators for regulation of breast cancer cell proliferation and estrogen receptor-alpha transcriptional activity.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19039327 2009 GAS, a new glutamate-rich protein, interacts differentially with SRCs and is involved in oestrogen receptor function.
18845648 2009 Expression and significance of androgen receptor coactivators in urothelial carcinoma of the bladder.
18798693 2008 Identification of COUP-TFII orphan nuclear receptor as a retinoic acid-activated receptor.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18563714 2008 ERAP75 functions as a coactivator to enhance estrogen receptor alpha transactivation in prostate stromal cells.
18284209 2008 Functional characterization of the native NH2-terminal transactivation domain of the human androgen receptor: binding kinetics for interactions with TFIIF and SRC-1a.
17919607 2008 Expression of androgen receptor co-regulators in the testes of men with azoospermia.
17673910 2007 Structural and functional characterization of a novel type of ligand-independent RXR-USP receptor.
17641689 2007 MED25 is distinct from TRAP220/MED1 in cooperating with CBP for retinoid receptor activation.
17627277 2007 PKA-induced resistance to tamoxifen is associated with an altered orientation of ERalpha towards co-activator SRC-1.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17476305 2007 SIP, a novel ankyrin repeat containing protein, sequesters steroid receptor coactivators in the cytoplasm.
17429319 2007 Pregnane X receptor polymorphism affects CYP3A4 induction via a ligand-dependent interaction with steroid receptor coactivator-1.
17363140 2007 The core component of the mammalian SWI/SNF complex SMARCD3/BAF60c is a coactivator for the nuclear retinoic acid receptor.
17254542 2007 The vitamin D receptor interacts preferentially with DRIP205-like LxxLL motifs.
17135255 2007 In vitro fluorescence anisotropy analysis of the interaction of full-length SRC1a with estrogen receptors alpha and beta supports an active displacement model for coregulator utilization.
17116691 2007 STAMP, a novel predicted factor assisting TIF2 actions in glucocorticoid receptor-mediated induction and repression.
16957778 2006 The catalytic subunit of the proteasome is engaged in the entire process of estrogen receptor-regulated transcription.
16882880 2006 Transcriptional activation of CYP2C9, CYP1A1, and CYP1A2 by hepatocyte nuclear factor 4alpha requires coactivators peroxisomal proliferator activated receptor-gamma coactivator 1alpha and steroid receptor coactivator 1.
16775354 2006 Human papillomavirus E7 oncoprotein dysregulates steroid receptor coactivator 1 localization and function.
16723356 2006 Distinct roles of the steroid receptor coactivator 1 and of MED1 in retinoid-induced transcription and cellular differentiation.
16606617 2006 Additional sex comb-like 1 (ASXL1), in cooperation with SRC-1, acts as a ligand-dependent coactivator for retinoic acid receptor.
16456540 2006 P38MAPK-dependent phosphorylation and degradation of SRC-3/AIB1 and RARalpha-mediated transcription.
16269961 2005 Variation in estrogen-related genes and cross-sectional and longitudinal blood pressure in the Framingham Heart Study.
15919756 2005 Synovial sarcoma translocation (SYT) encodes a nuclear receptor coactivator.
15862975 2005 Changes in the content of steroid receptor coactivator-1 and silencing mediator for retinoid and thyroid hormone receptors in the rat brain during the estrous cycle.
15831516 2005 Functional genomics identifies a mechanism for estrogen activation of the retinoic acid receptor alpha1 gene in breast cancer cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15774904 2005 Activation of ATP-binding cassette transporter A1 transcription by chromatin remodeling complex.
15615775 2005 Role of CBP in regulating HIF-1-mediated activation of transcription.
15572661 2004 Negative modulation of androgen receptor transcriptional activity by Daxx.
15572376 2005 Amino acids important for ligand specificity of the human constitutive androstane receptor.
15530426 2004 Region 752-761 of STAT3 is critical for SRC-1 recruitment and Ser727 phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456935 2004 SRC-1 is involved in the control of the gene expression of myelin protein Po.
15367689 2004 The ubiquitin-conjugating enzyme UBCH7 acts as a coactivator for steroid hormone receptors.
15313887 2004 Gene expression signatures identify rhabdomyosarcoma subtypes and detect a novel t(2;2)(q35;p23) translocation fusing PAX3 to NCOA1.
15249124 2004 hSrb7, an essential human Mediator component, acts as a coactivator for the thyroid hormone receptor.
15231721 2004 Tumor necrosis factor-alpha suppresses the expression of steroid receptor coactivator-1 and -2: a possible mechanism contributing to changes in steroid hormone responsiveness.
14757047 2004 Structure of the NCoA-1/SRC-1 PAS-B domain bound to the LXXLL motif of the STAT6 transactivation domain.
14715875 2004 Differential recruitment of coregulator proteins steroid receptor coactivator-1 and silencing mediator for retinoid and thyroid receptors to the estrogen receptor-estrogen response element by beta-estradiol and 4-hydroxytamoxifen in human breast cancer.
14684751 2004 The farnesoid X receptor controls gene expression in a ligand- and promoter-selective fashion.
14601091 2003 Expression of steroid receptor coactivators and corepressors in human endometrial hyperplasia and carcinoma with relevance to steroid receptors and Ki-67 expression.
12954634 2003 NCoA-1/SRC-1 is an essential coactivator of STAT5 that binds to the FDL motif in the alpha-helical region of the STAT5 transactivation domain.
12933903 2003 Steroid receptor coactivator 1 links the steroid and interferon gamma response pathways.
12917342 2003 BAF60a mediates critical interactions between nuclear receptors and the BRG1 chromatin-remodeling complex for transactivation.
12909012 2003 Coactivator binding promotes the specific interaction between ligand and the pregnane X receptor.
12578355 2003 2.1 A crystal structure of human PXR in complex with the St. John's wort compound hyperforin.
12569182 2003 Dissociation of steroid receptor coactivator 1 and nuclear receptor corepressor recruitment to the human glucocorticoid receptor by modification of the ligand-receptor interface: the role of tyrosine 735.
12529333 2003 Sumoylation of the progesterone receptor and of the steroid receptor coactivator SRC-1.
12482985 2003 Mediator and p300/CBP-steroid receptor coactivator complexes have distinct roles, but function synergistically, during estrogen receptor alpha-dependent transcription with chromatin templates.
12482968 2003 Activating signal cointegrator 2 belongs to a novel steady-state complex that contains a subset of trithorax group proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12403846 2002 Transcriptional synergism on the pS2 gene promoter between a p160 coactivator and estrogen receptor-alpha depends on the coactivator subtype, the type of estrogen response element, and the promoter context.
12208951 2002 Human immunodeficiency virus type 1 (HIV-1) accessory protein Vpr induces transcription of the HIV-1 and glucocorticoid-responsive promoters by binding directly to p300/CBP coactivators.
12189208 2002 Identification of a transcriptionally active peroxisome proliferator-activated receptor alpha -interacting cofactor complex in rat liver and characterization of PRIC285 as a coactivator.
12163482 2002 Ligand-independent activation of the androgen receptor by interleukin-6 and the role of steroid receptor coactivator-1 in prostate cancer cells.
12145209 2002 Targeting of SWI/SNF chromatin remodelling complexes to estrogen-responsive genes.
12138096 2002 An LXXLL motif in the transactivation domain of STAT6 mediates recruitment of NCoA-1/SRC-1.
12118039 2002 A point mutation of the AF2 transactivation domain of the glucocorticoid receptor disrupts its interaction with steroid receptor coactivator 1.
12114525 2002 Inhibitory cross-talk between estrogen receptor (ER) and constitutively activated androstane receptor (CAR). CAR inhibits ER-mediated signaling pathway by squelching p160 coactivators.
12082103 2002 The activation function-1 domain of Nur77/NR4A1 mediates trans-activation, cell specificity, and coactivator recruitment.
12039952 2002 Identification of protein arginine methyltransferase 2 as a coactivator for estrogen receptor alpha.
12024042 2002 Recruitment of the NCoA/SRC-1/p160 family of transcriptional coactivators by the aryl hydrocarbon receptor/aryl hydrocarbon receptor nuclear translocator complex.
11971985 2002 Regulation of SRC-3 (pCIP/ACTR/AIB-1/RAC-3/TRAM-1) Coactivator activity by I kappa B kinase.
11891224 2002 Cross-repression, a functional consequence of the physical interaction of non-liganded nuclear receptors and POU domain transcription factors.
11864604 2002 Structural and functional evidence for ligand-independent transcriptional activation by the estrogen-related receptor 3.
11831720 1995 Analysis of human immunodeficiency virus type 1 promoter insertion in vivo.
11818499 2002 Reduction of coactivator expression by antisense oligodeoxynucleotides inhibits ERalpha transcriptional activity and MCF-7 proliferation.
11773079 2002 Functional interaction of STAT3 transcription factor with the coactivator NcoA/SRC1a.
11704662 2002 Nuclear receptor coactivator p160 proteins enhance the HIV-1 long terminal repeat promoter by bridging promoter-bound factors and the Tat-P-TEFb complex.
11698662 2001 Structural determinants of ligand binding selectivity between the peroxisome proliferator-activated receptors.
11689423 2001 X-ray structure of the orphan nuclear receptor RORbeta ligand-binding domain in the active conformation.
11682626 2001 Synergism between ERalpha transactivation function 1 (AF-1) and AF-2 mediated by steroid receptor coactivator protein-1: requirement for the AF-1 alpha-helical core and for a direct interaction between the N- and C-terminal domains.
11514567 2001 Ternary complexes and cooperative interplay between NCoA-62/Ski-interacting protein and steroid receptor coactivators in vitamin D receptor-mediated transcription.
11330046 2000 Peroxisome proliferator-activated receptors, coactivators, and downstream targets.
11266503 2001 Regulation of glucocorticoid receptor activity by 14--3-3-dependent intracellular relocalization of the corepressor RIP140.
11250900 2001 A subfamily of RNA-binding DEAD-box proteins acts as an estrogen receptor alpha coactivator through the N-terminal activation domain (AF-1) with an RNA coactivator, SRA.
11165056 2001 Estrogen receptor alpha and estrogen receptor-related receptor alpha1 compete for binding and coactivator.
11136553 2000 Correlation of farnesoid X receptor coactivator recruitment and cholesterol 7alpha-hydroxylase gene repression by bile acids.
11113179 2001 Analysis of the steroid receptor coactivator 1 (SRC1)-CREB binding protein interaction interface and its importance for the function of SRC1.
11076796 2000 Temporal/spatial expression of nuclear receptor coactivators in the mouse lung.
11069927 2001 Role of accessory factors and steroid receptor coactivator 1 in the regulation of phosphoenolpyruvate carboxykinase gene transcription by glucocorticoids.
11050077 2001 Synergistic enhancement of nuclear receptor function by p160 coactivators and two coactivators with protein methyltransferase activities.
11003650 2000 BRG-1 is recruited to estrogen-responsive promoters and cooperates with factors involved in histone acetylation.
10934189 2000 Functional interaction between the p160 coactivator proteins and the transcriptional enhancer factor family of transcription factors.
10848596 2000 Peroxisome proliferator-activated receptor gamma-dependent repression of the inducible nitric oxide synthase gene.
10809226 2000 Selection of estrogen receptor beta- and thyroid hormone receptor beta-specific coactivator-mimetic peptides using recombinant peptide libraries.
10757795 2000 The opposing transcriptional activities of the two isoforms of the human progesterone receptor are due to differential cofactor binding.
10722692 2000 JAB1 interacts with both the progesterone receptor and SRC-1.
10713182 2000 The orphan nuclear receptor Ear-2 is a negative coregulator for thyroid hormone nuclear receptor function.
10688660 2000 E1A-mediated repression of progesterone receptor-dependent transactivation involves inhibition of the assembly of a multisubunit coactivation complex.
10660621 2000 Phosphorylation of steroid receptor coactivator-1. Identification of the phosphorylation sites and phosphorylation through the mitogen-activated protein kinase pathway.
10652338 2000 Transcription activation by the orphan nuclear receptor, chicken ovalbumin upstream promoter-transcription factor I (COUP-TFI). Definition of the domain involved in the glucocorticoid response of the phosphoenolpyruvate carboxykinase gene.
10594042 2000 Redox-regulated recruitment of the transcriptional coactivators CREB-binding protein and SRC-1 to hypoxia-inducible factor 1alpha.
10567563 1999 The AF1 and AF2 domains of the androgen receptor interact with distinct regions of SRC1.
10567404 1999 A nuclear factor, ASC-2, as a cancer-amplified transcriptional coactivator essential for ligand-dependent transactivation by nuclear receptors in vivo.
10558993 1999 Activation of PPARgamma coactivator-1 through transcription factor docking.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
10497212 1999 Bcl3, an IkappaB protein, stimulates activating protein-1 transactivation and cellular proliferation.
10454579 1999 Activating signal cointegrator 1, a novel transcription coactivator of nuclear receptors, and its cytosolic localization under conditions of serum deprivation.
10449719 1999 Steroid receptor coactivator-1 (SRC-1) enhances ligand-dependent and receptor-dependent cell-free transcription of chromatin.
10381882 1999 Regulation of transcription by a protein methyltransferase.
10334993 1999 Bile acids: natural ligands for an orphan nuclear receptor.
10334992 1999 Identification of a nuclear receptor for bile acids.
10207113 1999 Molecular determinants of the estrogen receptor-coactivator interface.
9878542 1998 The interaction of the vitamin D receptor with nuclear receptor corepressors and coactivators.
9874563 1999 The HIV-1 virion-associated protein vpr is a coactivator of the human glucocorticoid receptor.
9832502 1998 Ligand-independent recruitment of steroid receptor coactivators to estrogen receptor by cyclin D1.
9812974 1998 SRC-1 and GRIP1 coactivate transcription with hepatocyte nuclear factor 4.
9786846 1998 Steroid receptor coactivator-1 interacts with serum response factor and coactivates serum response element-mediated transactivations.
9782096 1998 Assignment of the steroid receptor coactivator-1 (SRC-1) gene to human chromosome band 2p23.
9744270 1998 Ligand binding and co-activator assembly of the peroxisome proliferator-activated receptor-gamma.
9642216 1998 Steroid receptor coactivator-1 coactivates activating protein-1-mediated transactivations through interaction with the c-Jun and c-Fos subunits.
9575154 1998 The steroid receptor coactivator-1 contains multiple receptor interacting and activation domains that cooperatively enhance the activation function 1 (AF1) and AF2 domains of steroid receptors.
9556555 1998 Steroid receptor coactivator-1 interacts with the p50 subunit and coactivates nuclear factor kappaB-mediated transactivations.
9488734 1998 The receptor-associated coactivator 3 activates transcription through CREB-binding protein recruitment and autoregulation.
9445475 1998 Transcription factor-specific requirements for coactivators and their acetyltransferase functions.
9427757 1998 Isoforms of steroid receptor co-activator 1 differ in their ability to potentiate transcription by the oestrogen receptor.
9407140 1997 p300 functions as a coactivator for the peroxisome proliferator-activated receptor alpha.
9328345 1997 The activation function-2 hexamer of steroidogenic factor-1 is required, but not sufficient for potentiation by SRC-1.
9296499 1997 Steroid receptor coactivator-1 is a histone acetyltransferase.
9223431 1997 A splicing variant of Steroid Receptor Coactivator-1 (SRC-1E): the major isoform of SRC-1 to mediate thyroid hormone action.
9223281 1997 Steroid receptor induction of gene transcription: a two-step model.
9171239 1997 Analysis of the functional role of steroid receptor coactivator-1 in ligand-induced transactivation by thyroid hormone receptor.
9041124 1996 Cloning and identification of mouse steroid receptor coactivator-1 (mSRC-1), as a coactivator of peroxisome proliferator-activated receptor gamma.
8754792 1996 Molecular cloning and properties of a full-length putative thyroid hormone receptor coactivator.
8616895 1996 A CBP integrator complex mediates transcriptional activation and AP-1 inhibition by nuclear receptors.
7481822 1995 Sequence and characterization of a coactivator for the steroid hormone receptor superfamily.