Property Summary

NCBI Gene PubMed Count 4
PubMed Score 73.78
PubTator Score 25.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 6.5e-27

Gene RIF (1)

AA Sequence

MTTATPLGDTTFFSLNMTTRGEDFLYKSSGAIVAAVVVVVIIIFTVVLILLKMYNRKMRTRRELEPKGPK      1 - 70
PTAPSAVGPNSNGSQHPATVTFSPVDVQVETR                                           71 - 102
//

Text Mined References (4)

PMID Year Title