Property Summary

NCBI Gene PubMed Count 213
PubMed Score 644.46
PubTator Score 1016.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Myocardial Ischemia 169
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 156 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 4.512 2.3

Expression

Gene RIF (151)

PMID Text
26540346 Data show that nucleolin (NCL) antagonist N6L inhibits cell growth with different sensitivity depending to NCL localization.
26399567 Nucleolin stabilizes oncostatin-M mRNA by binding to a GC-rich element in its 3'UTR.
26354862 Identification of NCL as a prominent host factor capable of binding with high affinity to the G4 structures present in the LTR promoter of HIV-1.
26283155 These results suggested a clear link between nucleolin expression (including cell membrane nucleolin) and the stem cell-like phenotype in breast cancer, namely in the triple negative molecular subtype.
26238070 HAUSP-nucleolin interaction is regulated by p53-Mdm2 complex in response to DNA damage.
26231209 C1q exists as the C1 complex (C1qC1r2C1s2), and C1q binding to ligands activates the C1r/C1s proteases. Incubation of nucleoli with C1 caused degradation of the nucleolar proteins nucleolin and nucleophosmin 1. T
26183533 study dissects nucleolin-mediated activation of surface AC133 and its cognate gene CD133, via specific interaction of nucleolin with the tissue-dependent CD133 promoter P1
25965334 Data suggest that NCL (nucleolin) is re-localized during lytic KSHV (Kaposi sarcoma-associated herpesvirus) infection and protects IL6 (interleukin-6) mRNA from SOX (KSHV cytoplasmic mRNA-specific endonuclease) degradation in cytoplasm.
25938538 NCL overexpression is involved in liver carcinogenesis.
25921135 Inhibition of C23 expression was shown to increase the radiosensitivity of NSCLC cells, as implied by the relevance to the notably decreased DNA-PKcs phosphorylation activity at the S2056 and T2609 clusters.
25866190 the multiple functions of NCL that are associated to its multiple cellular localization can participate to the development of cancer.
25698539 C23 protein meditates bone morphogenetic protein-2-mediated epithelial-to-mesenchymal transition via up-regulation of Erk1/Erk2 and Akt in gastric cancer.Correlations between C23, BMPRII expression and prognosis of gastric cancer patients.
25698534 The involvement of cell surface nucleolin in the initiation of CCR6 signaling in human hepatocellular carcinoma.Expression of nucleolin and CCR6 correlates with overall survival in hepatocellular carcinoma patients.
25631630 NCL is implicated in the initiation and transduction of EGFR and CXCR4 signaling in the esophageal squamous cell carcinomas.NCL is expressed in the esophageal squamous cell carcinoma tissues with metastasis in the cell membrane, cytoplasm and nucleus.
25590348 This study uncovered a new role for nucleolin in restricting microtubule nucleation and anchoring at centrosomes in interphase cells.
25561743 results for the first time demonstrate that nucleolin-SUMO at K294R plays a critical role in its nucleus sequestration and gadd45alpha mRNA binding activity.
25428867 Authors show that the largely nuclear P-protein isoform P3 can localize to nucleoli and forms specific interactions with nucleolin.
25367885 In U87 glioma cells, C23 plays a crucial role in activation of SDF-1-induced ERK and PI3K/AKT pathways via interacting with CXCR4. C23 interacted with CXCR4 once U87 was exposed to SDF-1 treatment.
25326811 nucleolin may interact with more G protein-coupled receptors, at least chemokine receptor. Our study will lay a new foundation for cancer therapy by antagonizing nucleolin and CXCR4.
25313645 Induced expression of NCL with mutated CK2 phosphorylation sites stabilizes p53, results in higher expression of Bcl2 (B-cell lymphoma 2) homology 3 (BH3)-only apoptotic markers and causes a dominant-negative effect on cell viability.
25290311 Nucleolin down-regulation is involved in ADP-induced cell cycle arrest in S phase and cell apoptosis in vascular endothelial cells.
25261371 Combined inhibition of nucleolin and ras prevents EGFR activation in glioblastoma cells, additively reducing tumorigenicity.
25230759 Increasing expression of nucleolin may be associated with aggressive characteristics of human hepatocellular carcinoma.
25169435 Data show that nucleolin and endogenous galectin-3 exist in the same complexes in the nucleolus, the cytoplasm, and on the cell surface of melanoma cells.
25092868 Syk binds robustly to nucleolin and phosphorylates it on tyrosine, enhancing its ability to bind and stabilize the Bcl-x(L) mRNA.
25015109 Studies identify nucleolin as an unconventional epigenetic regulator in leukemia cells and demonstrate nucleolin-NFkappaB-DNMT1 axis as a new molecular pathway underlying AML leukemogenesis.
24991885 Lrrc34, a novel nucleolar protein, interacts with npm1 and ncl and has an impact on pluripotent stem cells
24927373 Nucleolin was overexpressed in HCCLM9 cells at the protein and mRNA level. So nucleolin is a novel potential biomarker for the metastasis of hepatocellular carcinoma and a possible therapeutic target for the treatment of hepatocellular carcinoma patients.
24713430 Data indicate PI3K/Akt signaling as an essential pathway regulating the distribution of nucleolin.
24690621 HIV-1 gp120 downregulates the expression of nucleolin and modulates the expression of LC3, leading to autophage and cell death of uninfected CD4 T cells
24658146 Transient nucleolar localization of FMRP underlies a strong nucleocytoplasmic translocation, in a complex with nucleolin in order to regulate translation of its target mRNAs.
24632608 this study identified a novel role of the cleavage form of NCL generated by MMP7 in stabilizing MMP9 mRNA.
24595027 Nucleolin-FGF1 interaction is critical for the intranuclear phosphorylation of FGF1 by PKCdelta and thereby the regulation of nuclear export of FGF1.
24469254 The results show that surface nucleolin acts as an anti-carcinogenic mediator for HB-19
24452204 Nucleoli are rich in nucleolin, a potent transcription factor that we found to bind sites within the Ccnd1 gene specifically in mantke cell lymphoma cells and to activate Ccnd1 transcription.
24344309 NCL K429 has a role in Epstein-Barr virus nuclear antigen 1-mediated episome maintenance and transcription
24292944 Data show that nucleolin is a critical lipid-raft-dependent beta1-integrin-interacting protein in A375 melanoma cell spreading and migration on fibronectin.
24082117 nucleosome disruption is also dependent on nucleolin and is required for recruitment of replication protein A to DSBs, a marker of DSB processing that is a requisite for homologous recombination repair.
24027323 Host nucleolin interacts with the dengue virus capsid protein and plays a role in formation of infectious virus particles.
23918302 nucleolin is crucial in the activation of CXCR4 signaling, which affects cell growth, migration, and invasiveness.
23763304 A high level of nucleolar expression of nucleolin was an independent prognostic marker for better survival while high cytoplasmic staining was closely associated with worse prognosis for gastric cancer patients.
23726991 present study reveals that the expression of nucleolin is up-regulated, and plays a pro-angiogenic role during the recovery of heat-denatured dermis and its mechanism is probably dependent on production of VEGF
23610125 nucleolin posttranscriptionally regulates the expression of a specific subset of miRNAs, including miR-21, miR-221, miR-222, and miR-103, that are causally involved in breast cancer initiation, progression, and drug resistance.
23599269 Nucleolin inhibits Fas ligand binding and suppresses Fas-mediated apoptosis leading to B-cell lymphomas.
23471483 Nucleolin mediates microRNA-directed CSF-1 mRNA deadenylation but increases translation of CSF-1 mRNA.
23382938 This study demonstrates that nucleolin is associated with the clinical outcomes in postoperative NSCLC patients.
23353999 Acetylation defines a new pool of nucleolin which support a role for nucleolin in the regulation of mRNA maturation and transcription by RNA polymerase II.
23305559 The number of HDGF/nucleolin complexes is incresed by overexpression of full length bcl-2 mRNA whereas expression of only the bcl-2 coding sequence abolishes interaction completely.
23161541 alphavbeta3 integrin and nucleolin interact to regulate endothelial and glioma cell migration
23146273 Down regulation of Nucleolin expression inhibits adhesion and proliferation of HUVECs and blocks the inhibitory action of N6L.
23145133 Nucleolin has a major role in the DNA damage response.
23132587 group-oxidized cells underwent early apoptosis and were recognized by nucleolin on macrophages as early apoptotic cells
23125841 HIV-1 gp120 downregulates the expression of nucleolin and modulates the expression of LC3, leading to autophage and cell death of uninfected CD4 T cells
23076205 We conclude that NCL and HTERT represent the strongest prognostic biomarkers of relapse-free and overall survival, respectively, in our ependymoma case series.
22909121 NS1 protein of the human H3N2 virus interacts primarily via the C-terminal NLS2/NoLS and to a minor extent via the N-terminal NLS1 with the main nucleolar proteins, nucleolin, B23 and fibrillarin.
22743058 Hsc70 is a prerequisite for the surface translocation and angiogenic function of nucleolin, which suggests strategies to target both Hsc70 and NCL for more effective antiangiogenic therapies.
22693611 nucleolin plays a coregulatory role in transcriptional regulation of the tumor suppressor RARB2 by COUP-TFII
22675465 WRNp interacts with the RNA-binding protein, NCL.
22633274 is a possible relationship between the fragment peptide of nucleolin and the trigger of relapse in relapsing-remitting multiple sclerosis
22617883 The RNA-binding activities of nucleolin, its influence on gene expression patterns, and its impact upon diseases. [Review]
22433872 suggest a model in which the base pairings in the p53 UTR interaction regions are critical for both translational repression and stress induction of p53 by NCL and RPL26
22354986 nucleolin knockdown enhances spermidine/spermine-N(1)-acetyltransferase translation.
22349377 Down-regulation of C23 can contribute to cisplatin-mediated proliferation inhibition and apoptosis in SaOS-2 cells.
22318319 The nucleolar protein nucleolin interacts with a subunit of the viral DNA polymerase, UL44, specifically at the periphery of replication compartments.
22130536 found an increase in the nucleolar accumulation of US11 in nucleolin-depleted cells, thereby revealing that nucleolin could play a role in US11 nucleocytoplasmic trafficking through one-way directional transport out of the nucleolus
22103682 changes in nucleolin conformation can alter the availabilities of domains in vivo to modulate theoverall impact of nucleolin on Hdm2 activity and hence on p53 stability.
22049078 Nucleolin protein interacts with microprocessor complex to affect biogenesis of microRNAs 15a and 16
21938743 surface nucleolin increased with the malignancy grade thus suggesting that it may constitute a histopathological marker for glioma grading
21859890 HUR was found to interact with the nucleolin (NCL) 3'UTR and specifically promoted nucleolin translation without affecting nucleolin mRNA levels.
21841784 Nucleolin is a cellular receptor for human respiratory syncytial virus.
21812966 Results suggest that targeting surface nucleolin could change the organization of the 500-kDa complex to interfere with the proper functioning of surface nucleolin and the associated proteins, and thus lead to distinct inhibitory mechanisms.
21723257 the human cell surface nucleolin as a putative Crimean-Congo hemorrhagic fever virus entry factor was indentified.
21575459 Downregulation of cell-surface nucleolin expression inhibits the growth of hepatocellular carcinoma cells in vitro.
21575138 investigation of N-glycosylation on properties of recombinant nucleolin-derived peptide fragments emphasizing roles of RNA-binding domains: data suggest that N-glycosylation influences structure of nucleolin to enhance its self-association
21474449 NVL2 might facilitate the dissociation and recycling of nucleolin, thereby promoting efficient ribosome biogenesis
21466159 Heterogeneous nuclear ribonucleoprotein K and nucleolin transcriptionally activate the vascular endothelial growth factor promoter through interaction with secondary DNA structures
21440621 nucleolin is associated with Rb controls Cell cycle-dependent CD34 expression.
21436219 Nucleolin is not only recruited to the EPEC infection site but is also sequestered transiently inside extracellularly located bacterial microcolonies.
21310483 High C23 nucleolin protein is associated with relapsed/refractory acute leukemia.
21281639 During cell adhesion (induced by arachidonic acid), nucleolin, RhoA, and ROCK form a complex; cell adhesion is inhibited when formation of this complex is inhibited by various means.
21257709 Findings suggest strategies to target nucleolin as a general approach to inhibiting ErbB- and Ras-driven cancers.
21203423 nucleolin is constantly induced in tumor cells to mediate calcium-dependent ligand internalization
21152024 nucleolin and LAMP-1 have a role in promoting infection of human monocytes by Francisella tularensis
21060685 conclude that RNPs containing hY RNAs and Ro60, La or nucleolin are not required for the function of hY RNAs in chromosomal DNA replication in a human cell-free system, which can be mediated by Y RNAs outside of these RNPs
20628027 A high level of nucleolar expression of nucleolin was an independent prognostic marker for better survival for patients with stage II PDAs.
20571027 the degradation of bcl-2 mRNA induced by AS1411 results from both interference with nucleolin protection of bcl-2 mRNA and recruitment of the exosome by AUF1.
20506485 Data show that si-RNA induced down-regulation of FUT1 and FUT2 reduced expression of fucosylated nucleolin glycoforms and their exposure at the cell surface.
20075200 The observed colocalization of BRCA1 and nucleolin raises new possibilities for the nucleoplasm-nucleolus pathways of these proteins and their functional significance.
20011528 These data add the nucleolin-Stat1 complex as a novel functional partner for the cell differentiation program, which is uniquely poised to regulate the transcription machinery via Stat1 and nuclear metabolism via nucleolin.
20007282 results indicate an association of nucleolin and UL44 in HCMV-infected cells and a role for nucleolin in viral DNA synthesis
19884766 HIV-1 gp120 downregulates the expression of nucleolin and modulates the expression of LC3, leading to autophage and cell death of uninfected CD4 T cells
19864385 highly conserved residues in UL24 are important for the ability of the protein to modify the nuclear distribution of nucleolin
19757191 Results indicate an important negative regulatory role for nucleolin in the apoptosis of endothelial cells, likely involving the Bax pathway.
19657047 Plasma membrane nucleolin functions as a cell surface receptor for DNA aptamer AS1411 in leukemia cell line MV4-11.
19615975 nucleolin associated with the HPV16 genome stably maintained in HPV16-infected W12 cells, suggesting that the nucleolin binding may be involved in the dynamics of the HPV genome in cells.
19581307 Nucleolin binding facilitates the formation and increases the stability of the c-myc G-quadruplex structure.
19554553 Overexpression of nucleolin in engrafted acute myelogenous leukemia cells.
19515042 altered nuclear nucleolin expression seems to accompany melanoma progression
19492063 HIV-1 gp120 downregulates the expression of nucleolin and modulates the expression of LC3, leading to autophage and cell death of uninfected CD4 T cells
19409963 study found the expression of nucleolin was dramatically reduced in the substantia nigra pars compacta of Parkinson disease (PD) subjects; results suggest that nucleolin influences specific molecular mechanisms known to be associated with PD pathogenesis
19393617 PinX1 is recruited to chromosome periphery by Nucleolin and a complex of PinX1 and Nucleolin is essential for faithful chromosome congression.
19332556 The 50S U3 snoRNP is an small subunit assembly intermediate that is likely recruited to the pre-rRNA through the RNA-binding proteins nucleolin and RRP5.
19225898 Treatment of endothelial cells with anti-nucleolin antibody NCL3 leads to a decrease of mRNA levels of the anti-apoptotic molecule Bcl-2 and as a consequence induces endothelial cell apoptosis as evidenced by PARP cleavage.
19060367 Nucleolin expresses on the cell surface of THP-1 monocytes and is involved in the LPS-mediated expression and secretion of TNF-alpha and IL-1beta.
19026635 Binding of an extracellular ligand to surface nucleolin could be involved in the activation of signaling pathways by promoting Ca(2+) entry into cells.
18789156 the interaction between surface nucleolin and its bacterial ligand EF-Tu plays an important role in Francisella tularensis adhesion and entry process and may therefore facilitate invasion of host tissues
18701711 Low nucleolin expression was the single most important biological predictor of outcome in pediatric intracranial ependymoma.
18618420 Although S100A11 is initially expressed in the cytoplasm, it is transported to the nucleus by the action of nucleolin.
18504038 Results show that nucleolin is a signaling receptor for P-selectin on Colo-320 cells and suggest a mechanism for linkage of nucleolin to signal transduction pathways that regulate adhesion and spreading of Colo-320 on fibronectin substrates.
18321972 Using small interfering RNA technology, we show that viral replication requires a high level of nucleolin expression, demonstrating for the first time a direct role for a nucleolar protein in herpes simplex virus biology.
18299322 the nucleolus exhibits an osmotically regulated gatekeeping activity that controls the spatial dynamics and functions of nucleolin
18292223 Evidence that BIG1 and nucleolin, but not fibrillarin, can be present with p62 at the nuclear envelope confirms the presence of BIG1 and nucleolin in dynamic molecular complexes that change in composition while moving through nuclei
17767916 a novel function of Influenza A virus NS1, namely, affecting cellular events via interaction with nucleolin
17692122 Data show that, in addition to the expected effects on pre-ribosomal RNA accumulation and nucleolar structure, the absence of nucleolin results in a cell growth arrest, accumulation in G2, and an increase of apoptosis.
17674968 The repressive activity of GZF1 is modulated by the level at which nucleolin is expressed.
17626252 Nucleolin interacts with the AP-1 site within the promoter sequence of the metalloproteinase-13 gene.
17535846 Results indicate that nucleolin is required for nucleolus formation, and is also involved in chromosome congression and spindle formation.
17255095 nucleolin acts as a component of the gene regulation program of CD34-positive hematopoietic
17130237 Nucleolin was identified as a protein that allows RNA polymerase II to transcribe nucleosomal templates in vitro.
16982033 The functional consequences of the identified PIDD/nucleolin interaction remain to be elucidated, but may be related to a recently discovered new role for PIDD in the activation of NF-kappaB upon genotoxic stress.
16889753 data provide evidence of a nucleolar localization of K-Ras4B and describe a functional association between K-Ras4B and nucleolin
16777843 cross-dependence between aprataxin and nucleolin in the nucleolus
16751805 nucleolin, like ARF, responds to hyperproliferative signals by upregulation of p53 through Hdm2 inhibition
16698799 intracellular distribution of nucleolin in epithelial cells is Rb-dependent, and an altered nucleolin localization in human cancerous tissues results from a loss of Rb
16601700 Nucleolin greatly enhances the activity of the chromatin remodeling machineries SWI/SNF and ACF
16582966 In cells transfected with both IRF-2 and p300/CBP-associated factor , IRF-2 associated with endogenous nucleolin.
16571724 nucleolin binds the KLF2 promoter
16508016 3'UTR-bound nucleolin enhances mRNA stability of beta-globin
16403913 VEGF, extracellular matrix, and intracellular motor protein MyH9 are all essential for the novel function of nucleolin in angiogenesis.
16329155 The present results indicate that PP1 and nucleolin were differently expressed at G(1)/S and G(2)/M boundaries of the cell cycle and acted in a different fashion during cell-cycle progression.
16245305 Changes in the subcellular distribution and expression level of nucleolin play an important role in intestinal cell differentiation and relay the signaling pathway induced by laminin-1.
16212410 nucleolin and poly[ADP-ribosyl] transferase have roles in drug resistance
16156786 results demonstrate that PTN inhibits HIV infection and suggest that the cell surface-expressed nucleolin is a low affinity receptor for PTN binding to cells and it is also implicated in PTN entry into cells by an active process
16153722 RNA/protein interaction studies show binding of nucleolin to 3'UTR may be of major importance for increased efficiency of MMP-9 translation.MMP-9 expression can be regulated posttranscriptionally, affecting efficiency of translation & localization of mRNA
16135517 Nucleolin was detected at the surface of macrophages, and anti-nucleolin antibody inhibited the binding of the early apoptotic cells to macrophages.
15823039 identification of N317 and N492 as the two N-glycosylation sites
15492114 Retinoic acid-induced apoptosis is a consequence of cellular differentiation, which leads to nucleolin down-regulation and bcl-2 mRNA instability.
15371412 interaction of hTERT and nucleolin participates in the dynamic intracellular localization of telomerase complex
14978336 HIV-1 gp120 downregulates the expression of nucleolin and modulates the expression of LC3, leading to autophage and cell death of uninfected CD4 T cells
14679209 nucleolin functions as a bcl-2-stabilizing factor and that taxol and okadaic acid treatment induces apoptosis in HL-60 cells through a process that involves down-regulation of nucleolin and destabilization of bcl-2 mRNA
14638862 The cell surface molecule recognized by F3 is nucleolin. Nucleolin specifically bound to an F3 peptide affinity matrix from extracts of cultured breast carcinoma cells.
12804115 we propose a autoregulatory model in which Nucleolin regulates the translation of Nucleolin mRNA, such that during a period of excess protein, translation is inhibited through direct binding of Nucleolin protein to its mRNA.
12634843 Bidirectional DNA unwinding is achieved by a ternary complex of T antigen, this protein and DNA topoisomerase I.
12565890 Results show that nucleolin interacts with centaurin-alpha(1) protein, suggesting that centaurin-alpha(1) may be part of a ribonucleoprotein complex.
12559966 Data suggest that changes in nucleolin or argyrophilic nucleolar organizer region proteins occur in cells induced to undergo apoptosis by okadaic acid and by other stimuli.
12506112 change in levels and localization accompanies apoptosis in leukemia cells
12147681 results suggest that the cell surface-expressed nucleolin serves as a low affinity receptor for midkine and could be implicated in its entry process
12138209 These data indicate a novel p53-dependent mechanism in which cell stress mobilizes nucleolin for transient replication inhibition and DNA repair.
12096904 functions in the biogenesis and/or trafficking of hY1 and hY3 RNPs through the nucleolus and subsequent transport to the cytoplasm
12027446 Anchorage of HIV particles on permissive cells induces aggegation of surface nucleolin and its association with detergent-insoluble lipid raft components. Moreover, surface nucleolin and lipid rafts are implicated in the HIV entry process.
12027446 HIV-1 gp120 downregulates the expression of nucleolin and modulates the expression of LC3, leading to autophage and cell death of uninfected CD4 T cells

AA Sequence

MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTK      1 - 70
KVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNA     71 - 140
KKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEA    141 - 210
METTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKR    211 - 280
KKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFG    281 - 350
YVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIR    351 - 420
LVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKTLVL    421 - 490
SNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGP    491 - 560
RGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAM    561 - 630
EDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDH    631 - 700
KPQGKKTKFE                                                                701 - 710
//

Text Mined References (232)

PMID Year Title
26540346 2015 Nucleolin antagonist triggers autophagic cell death in human glioblastoma primary cells and decreased in vivo tumor growth in orthotopic brain tumor model.
26399567 2016 Stabilization of Oncostatin-M mRNA by Binding of Nucleolin to a GC-Rich Element in Its 3'UTR.
26354862 2015 Nucleolin stabilizes G-quadruplex structures folded by the LTR promoter and silences HIV-1 viral transcription.
26283155 2015 Nucleolin overexpression in breast cancer cell sub-populations with different stem-like phenotype enables targeted intracellular delivery of synergistic drug combination.
26238070 2015 HAUSP-nucleolin interaction is regulated by p53-Mdm2 complex in response to DNA damage response.
26231209 2015 C1q protein binds to the apoptotic nucleolus and causes C1 protease degradation of nucleolar proteins.
26183533 2015 Control of AC133/CD133 and impact on human hematopoietic progenitor cells through nucleolin.
25965334 2015 A ribonucleoprotein complex protects the interleukin-6 mRNA from degradation by distinct herpesviral endonucleases.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25938538 2015 Hepatoma-derived growth factor/nucleolin axis as a novel oncogenic pathway in liver carcinogenesis.
25921135 2015 Knocking Down Nucleolin Expression Enhances the Radiosensitivity of Non-Small Cell Lung Cancer by Influencing DNA-PKcs Activity.
25866190 2015 The roles of nucleolin subcellular localization in cancer.
25698539 2015 C23 protein meditates bone morphogenetic protein-2-mediated EMT via up-regulation of Erk1/2 and Akt in gastric cancer.
25698534 2015 The involvement of cell surface nucleolin in the initiation of CCR6 signaling in human hepatocellular carcinoma.
25631630 2015 The implications and mechanisms of the extra-nuclear nucleolin in the esophageal squamous cell carcinomas.
25590348 2015 Centrosomal nucleolin is required for microtubule network organization.
25561743 2015 A novel post-translational modification of nucleolin, SUMOylation at Lys-294, mediates arsenite-induced cell death by regulating gadd45? mRNA stability.
25428867 2015 Identification of a role for nucleolin in rabies virus infection.
25367885 2015 Nuclear Protein C23 on the Cell Surface Plays an Important Role in Activation of CXCR4 Signaling in Glioblastoma.
25326811 2015 Cell surface nucleolin interacts with CXCR4 receptor via the 212 c-terminal portion.
25313645 2014 Induced expression of nucleolin phosphorylation-deficient mutant confers dominant-negative effect on cell proliferation.
25290311 2014 Nucleolin down-regulation is involved in ADP-induced cell cycle arrest in S phase and cell apoptosis in vascular endothelial cells.
25261371 2014 Interfering with the interaction between ErbB1, nucleolin and Ras as a potential treatment for glioblastoma.
25230759 2014 Increased level of nucleolin confers to aggressive tumor progression and poor prognosis in patients with hepatocellular carcinoma after hepatectomy.
25169435 2014 The lectin-binding pattern of nucleolin and its interaction with endogenous galectin-3.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25092868 2014 Syk interacts with and phosphorylates nucleolin to stabilize Bcl-x(L) mRNA and promote cell survival.
25015109 2014 A nucleolin-DNMT1 regulatory axis in acute myeloid leukemogenesis.
24991885 2014 Lrrc34, a novel nucleolar protein, interacts with npm1 and ncl and has an impact on pluripotent stem cells.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24927373 2014 Nucleolin identified by comparative mass?spectra analysis is a potential marker for invasive progression of hepatocellular carcinoma.
24713430 2014 Phosphorylation and changes in the distribution of nucleolin promote tumor metastasis via the PI3K/Akt pathway in colorectal carcinoma.
24658146 2014 Subcellular fractionation and localization studies reveal a direct interaction of the fragile X mental retardation protein (FMRP) with nucleolin.
24632608 2015 MMP7-mediated cleavage of nucleolin at Asp255 induces MMP9 expression to promote tumor malignancy.
24595027 2014 Nucleolin regulates phosphorylation and nuclear export of fibroblast growth factor 1 (FGF1).
24515436 2014 ANKRD1 acts as a transcriptional repressor of MMP13 via the AP-1 site.
24469254 2014 Cell-surface nucleolin acts as a central mediator for carcinogenic, anti-carcinogenic, and disease-related ligands.
24452204 2014 Perinucleolar relocalization and nucleolin as crucial events in the transcriptional activation of key genes in mantle cell lymphoma.
24344309 2014 Nucleolin is important for Epstein-Barr virus nuclear antigen 1-mediated episome binding, maintenance, and transcription.
24292944 2013 Identification of nucleolin as a lipid-raft-dependent ?1-integrin-interacting protein in A375 cell migration.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24082117 2013 Nucleolin mediates nucleosome disruption critical for DNA double-strand break repair.
24071584 2014 macroH2A1 histone variant represses rDNA transcription.
24027323 2013 Nucleolin interacts with the dengue virus capsid protein and plays a role in formation of infectious virus particles.
23918302 2014 Cell surface nucleolin is crucial in the activation of the CXCL12/CXCR4 signaling pathway.
23848194 2013 Nucleolar scaffold protein, WDR46, determines the granular compartmental localization of nucleolin and DDX21.
23763304 2013 Overexpression of nucleolin and different expression sites both related to the prognosis of gastric cancer.
23728934 2013 Polygenic transmission and complex neuro developmental network for attention deficit hyperactivity disorder: genome-wide association study of both common and rare variants.
23726991 2013 The expression and proangiogenic effect of nucleolin during the recovery of heat-denatured HUVECs.
23610125 2013 In vivo NCL targeting affects breast cancer aggressiveness through miRNA regulation.
23599269 2013 Nucleolin inhibits Fas ligand binding and suppresses Fas-mediated apoptosis in vivo via a surface nucleolin-Fas complex.
23568457 2013 Genetic variants associated with disordered eating.
23471483 2013 Nucleolin mediates microRNA-directed CSF-1 mRNA deadenylation but increases translation of CSF-1 mRNA.
23382938 2013 Prognostic significance of the combined score of endothelial expression of nucleolin and CD31 in surgically resected non-small cell lung cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23353999 2013 Characterization of nucleolin K88 acetylation defines a new pool of nucleolin colocalizing with pre-mRNA splicing factors.
23305559 2013 Hepatoma-derived growth factor and nucleolin exist in the same ribonucleoprotein complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23161541 2013 Interplay between ?v?3 integrin and nucleolin regulates human endothelial and glioma cell migration.
23146273 2012 Nucleolin mediates the antiangiogenesis effect of the pseudopeptide N6L.
23145133 2012 Nucleolin participates in DNA double-strand break-induced damage response through MDC1-dependent pathway.
23132587 2012 Macrophage recognition of thiol-group oxidized cells: recognition of carbohydrate chains by macrophage surface nucleolin as apoptotic cells.
23076205 2012 Predictors of outcome in an AIEOP series of childhood ependymomas: a multifactorial analysis.
22909121 2012 Influenza A H3N2 subtype virus NS1 protein targets into the nucleus and binds primarily via its C-terminal NLS2/NoLS to nucleolin and fibrillarin.
22743058 2012 Heat shock cognate 70 regulates the translocation and angiogenic function of nucleolin.
22693611 2012 Identification and characterization of nucleolin as a COUP-TFII coactivator of retinoic acid receptor ? transcription in breast cancer cells.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22675465 2012 Nucleolin inhibits G4 oligonucleotide unwinding by Werner helicase.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22633274 2012 Decreased serum levels of nucleolin protein fragment, as analyzed by bead-based proteomic technology, in multiple sclerosis patients compared to controls.
22617883 2012 RNA-binding protein nucleolin in disease.
22433872 2012 Interactions of nucleolin and ribosomal protein L26 (RPL26) in translational control of human p53 mRNA.
22354986 2012 Polyamine-regulated translation of spermidine/spermine-N1-acetyltransferase.
22349377 2012 [Effect of C23 down-regulation on proliferation inhibition and apoptosis induced by cisplatin in human osteosarcoma SaOS-2 cells].
22318319 2012 Host cell nucleolin is required to maintain the architecture of human cytomegalovirus replication compartments.
22130536 2012 Nucleolin interacts with US11 protein of herpes simplex virus 1 and is involved in its trafficking.
22103682 2012 Specific domains of nucleolin interact with Hdm2 and antagonize Hdm2-mediated p53 ubiquitination.
22049078 2011 Nucleolin protein interacts with microprocessor complex to affect biogenesis of microRNAs 15a and 16.
21938743 2012 Glycosilated nucleolin as marker for human gliomas.
21859890 2011 Competitive regulation of nucleolin expression by HuR and miR-494.
21841784 2011 Identification of nucleolin as a cellular receptor for human respiratory syncytial virus.
21812966 2011 Targeting surface nucleolin with multivalent HB-19 and related Nucant pseudopeptides results in distinct inhibitory mechanisms depending on the malignant tumor cell type.
21723257 2011 Identification of a putative Crimean-Congo hemorrhagic fever virus entry factor.
21700224 2011 Human senataxin resolves RNA/DNA hybrids formed at transcriptional pause sites to promote Xrn2-dependent termination.
21575459 2011 [Downregulation of cell-surface-expressed nucleolin inhibits the growth of hepatocellular carcinoma cells in vitro].
21575138 2011 N-Glycosylation influences the structure and self-association abilities of recombinant nucleolin.
21536856 2011 Splicing factor 2-associated protein p32 participates in ribosome biogenesis by regulating the binding of Nop52 and fibrillarin to preribosome particles.
21474449 2011 Structure and function of the N-terminal nucleolin binding domain of nuclear valosin-containing protein-like 2 (NVL2) harboring a nucleolar localization signal.
21466159 2011 Heterogeneous nuclear ribonucleoprotein K and nucleolin as transcriptional activators of the vascular endothelial growth factor promoter through interaction with secondary DNA structures.
21440621 2011 Rb and nucleolin antagonize in controlling human CD34 gene expression.
21436219 2011 Cell-surface nucleolin is sequestered into EPEC microcolonies and may play a role during infection.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21310483 2011 DIGE-based proteomic analysis identifies nucleophosmin/B23 and nucleolin C23 as over-expressed proteins in relapsed/refractory acute leukemia.
21281639 2011 Arachidonic acid stimulates formation of a novel complex containing nucleolin and RhoA.
21269460 2011 Initial characterization of the human central proteome.
21257709 2011 Oncogenic synergism between ErbB1, nucleolin, and mutant Ras.
21203423 2010 Surface expressed nucleolin is constantly induced in tumor cells to mediate calcium-dependent ligand internalization.
21152024 2010 Nucleolin, a shuttle protein promoting infection of human monocytes by Francisella tularensis.
21060685 2010 Ribonucleoprotein particles containing non-coding Y RNAs, Ro60, La and nucleolin are not required for Y RNA function in DNA replication.
20858735 2010 Interactions of ErbB4 and Kap1 connect the growth factor and DNA damage response pathways.
20628027 2010 High levels of nucleolar expression of nucleolin are associated with better prognosis in patients with stage II pancreatic ductal adenocarcinoma.
20571027 2010 Mechanism of regulation of bcl-2 mRNA by nucleolin and A+U-rich element-binding factor 1 (AUF1).
20506485 2010 RNA-mediated gene silencing of FUT1 and FUT2 influences expression and activities of bovine and human fucosylated nucleolin and inhibits cell adhesion and proliferation.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20221403 2010 Phosphorylation of human tristetraprolin in response to its interaction with the Cbl interacting protein CIN85.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20075200 2010 BRCA1 protein and nucleolin colocalize in breast carcinoma tissue and cancer cell lines.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20011528 2009 Stat1 nuclear translocation by nucleolin upon monocyte differentiation.
20007282 2010 Nucleolin associates with the human cytomegalovirus DNA polymerase accessory subunit UL44 and is necessary for efficient viral replication.
19946888 2010 Defining the membrane proteome of NK cells.
19877579 2009 The heparin binding motif of endostatin mediates its interaction with receptor nucleolin.
19864385 2010 Conserved residues in the UL24 protein of herpes simplex virus 1 are important for dispersal of the nucleolar protein nucleolin.
19757191 2010 Nucleolin/C23 is a negative regulator of hydrogen peroxide-induced apoptosis in HUVECs.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19657047 2009 Plasma membrane nucleolin is a receptor for the anticancer aptamer AS1411 in MV4-11 leukemia cells.
19615975 2009 Identification of nucleolin as a protein that binds to human papillomavirus type 16 DNA.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19581307 2009 Identification and characterization of nucleolin as a c-myc G-quadruplex-binding protein.
19554553 2009 Overexpression of nucleolin in engrafted acute myelogenous leukemia cells.
19515850 2009 Functional role for senataxin, defective in ataxia oculomotor apraxia type 2, in transcriptional regulation.
19515042 2009 Nucleolin protein expression in cutaneous melanocytic lesions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19409963 2009 A role for a novel protein, nucleolin, in Parkinson's disease.
19393617 2009 PinX1 is recruited to the mitotic chromosome periphery by Nucleolin and facilitates chromosome congression.
19332556 2009 A novel small-subunit processome assembly intermediate that contains the U3 snoRNP, nucleolin, RRP5, and DBP4.
19225898 2009 Cell surface nucleolin antagonist causes endothelial cell apoptosis and normalization of tumor vasculature.
19174163 2009 Proteomic and genomic analysis of PITX2 interacting and regulating networks.
19060367 2008 [Role of cell-surface nucleolin in lipopolysaccharide-stimulated expression and secretion of TNF-alpha and IL-1beta].
19026635 2009 The cell surface expressed nucleolin is a glycoprotein that triggers calcium entry into mammalian cells.
18809582 2008 Nucleophosmin serves as a rate-limiting nuclear export chaperone for the Mammalian ribosome.
18789156 2008 A novel receptor - ligand pathway for entry of Francisella tularensis in monocyte-like THP-1 cells: interaction between surface nucleolin and bacterial elongation factor Tu.
18701711 2008 Multifactorial analysis of predictors of outcome in pediatric intracranial ependymoma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18618420 2008 The structure of S100A11 fragment explains a local structural change induced by phosphorylation.
18504038 2008 Cell-surface nucleolin is a signal transducing P-selectin binding protein for human colon carcinoma cells.
18457437 2008 Identification of intracellular proteins associated with the EBV-encoded nuclear antigen 5 using an efficient TAP procedure and FT-ICR mass spectrometry.
18321972 2008 Nucleolin is required for an efficient herpes simplex virus type 1 infection.
18299322 2008 The nucleolus exhibits an osmotically regulated gatekeeping activity that controls the spatial dynamics and functions of nucleolin.
18292223 2008 Association of guanine nucleotide-exchange protein BIG1 in HepG2 cell nuclei with nucleolin, U3 snoRNA, and fibrillarin.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17928403 2007 Epidermal growth factor increases the interaction between nucleolin and heterogeneous nuclear ribonucleoprotein K/poly(C) binding protein 1 complex to regulate the gastrin mRNA turnover.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17767916 2007 Influenza A virus non-structural protein 1 (NS1) interacts with cellular multifunctional protein nucleolin during infection.
17692122 2007 Inactivation of nucleolin leads to nucleolar disruption, cell cycle arrest and defects in centrosome duplication.
17674968 2007 Nucleolin modulates the subcellular localization of GDNF-inducible zinc finger protein 1 and its roles in transcription and cell proliferation.
17626252 2008 Nucleolin binds specifically to an AP-1 DNA sequence and represses AP1-dependent transactivation of the matrix metalloproteinase-13 gene.
17620599 2007 Functional specialization of beta-arrestin interactions revealed by proteomic analysis.
17615292 2007 Nucleolin is a receptor that mediates antiangiogenic and antitumor activity of endostatin.
17535846 2007 Nucleolin functions in nucleolus formation and chromosome congression.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17289661 2007 Molecular composition of IMP1 ribonucleoprotein granules.
17255095 2007 Nucleolin regulates gene expression in CD34-positive hematopoietic cells.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17215513 2007 Aurora-B regulates RNA methyltransferase NSUN2.
17130237 2007 Nucleolin is required for RNA polymerase I transcription in vivo.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16982033 2006 Upon intracellular processing, the C-terminal death domain-containing fragment of the p53-inducible PIDD/LRDD protein translocates to the nucleoli and interacts with nucleolin.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16889753 2006 K-Ras4B proteins are expressed in the nucleolus: Interaction with nucleolin.
16777843 2006 Nucleolar localization of aprataxin is dependent on interaction with nucleolin and on active ribosomal DNA transcription.
16751805 2006 Nucleolin inhibits Hdm2 by multiple pathways leading to p53 stabilization.
16698799 2006 Cell cycle-controlled interaction of nucleolin with the retinoblastoma protein and cancerous cell transformation.
16648475 2006 Nucleophosmin is essential for ribosomal protein L5 nuclear export.
16601700 2006 Nucleolin is a histone chaperone with FACT-like activity and assists remodeling of nucleosomes.
16582966 2006 Nucleolin is involved in interferon regulatory factor-2-dependent transcriptional activation.
16571724 2006 Up-regulation of the KLF2 transcription factor by fluid shear stress requires nucleolin.
16508016 2006 A nucleolin-binding 3' untranslated region element stabilizes beta-globin mRNA in vivo.
16403913 2006 The angiogenic function of nucleolin is mediated by vascular endothelial growth factor and nonmuscle myosin.
16341674 2005 Transcriptome analysis of human gastric cancer.
16329155 Differential expression of protein phosphatase type 1 isotypes and nucleolin during cell cycle arrest.
16245305 2006 Effect of laminin-1 on intestinal cell differentiation involves inhibition of nuclear nucleolin.
16212410 Proteomic evidence for roles for nucleolin and poly[ADP-ribosyl] transferase in drug resistance.
16156786 2005 Pleiotrophin inhibits HIV infection by binding the cell surface-expressed nucleolin.
16153722 2005 Role of nucleolin in posttranscriptional control of MMP-9 expression.
16135517 2005 A multifunctional shuttling protein nucleolin is a macrophage receptor for apoptotic cells.
15848144 2005 Proteomic analysis of complexes formed by human topoisomerase I.
15823039 2005 Nucleolin undergoes partial N- and O-glycosylations in the extranuclear cell compartment.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15674325 2005 PARP-10, a novel Myc-interacting protein with poly(ADP-ribose) polymerase activity, inhibits transformation.
15492114 2005 Retinoid-induced apoptosis in HL-60 cells is associated with nucleolin down-regulation and destabilization of Bcl-2 mRNA.
15371412 2004 Nucleolin interacts with telomerase.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
15121898 2004 The composition of Staufen-containing RNA granules from human cells indicates their role in the regulated transport and translation of messenger RNAs.
15064750 2004 EBP1 is a nucleolar growth-regulating protein that is part of pre-ribosomal ribonucleoprotein complexes.
15044383 2004 Aprataxin, a novel protein that protects against genotoxic stress.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14679209 2004 Identification of nucleolin as an AU-rich element binding protein involved in bcl-2 mRNA stabilization.
14638862 2003 Nucleolin expressed at the cell surface is a marker of endothelial cells in angiogenic blood vessels.
14623863 2003 S100C/A11 is a key mediator of Ca(2+)-induced growth inhibition of human epidermal keratinocytes.
12944467 2003 Werner syndrome protein phosphorylation by abl tyrosine kinase regulates its activity and distribution.
12804115 2003 Stability of Nucleolin protein as the basis for the differential expression of Nucleolin mRNA and protein during serum starvation.
12634843 2003 Bidirectional DNA unwinding by a ternary complex of T antigen, nucleolin and topoisomerase I.
12565890 2003 Centaurin-alpha 1 associates in vitro and in vivo with nucleolin.
12559966 2003 Cleavage of nucleolin and argyrophilic nucleolar organizer region associated proteins in apoptosis-induced cells.
12506112 2003 Apoptosis in leukemia cells is accompanied by alterations in the levels and localization of nucleolin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
12427757 2003 Direct interaction between nucleolin and hepatitis C virus NS5B.
12388589 2002 A receptor for activated C kinase is part of messenger ribonucleoprotein complexes associated with polyA-mRNAs in neurons.
12324461 2002 Molecular basis for the loss of CD28 expression in senescent T cells.
12185196 2002 Interaction of protein phosphatase 1 delta with nucleolin in human osteoblastic cells.
12147681 2002 The anti-HIV cytokine midkine binds the cell surface-expressed nucleolin as a low affinity receptor.
12138209 2002 Stress-dependent nucleolin mobilization mediated by p53-nucleolin complex formation.
12096904 2002 Nucleolin associates with a subset of the human Ro ribonucleoprotein complexes.
12029088 2002 Identification of novel SH3 domain ligands for the Src family kinase Hck. Wiskott-Aldrich syndrome protein (WASP), WASP-interacting protein (WIP), and ELMO1.
11438699 2001 A highly conserved protein family interacting with the fragile X mental retardation protein (FMRP) and displaying selective interactions with FMRP-related proteins FXR1P and FXR2P.
11162542 2001 Identification of nucleolin as a glucocorticoid receptor interacting protein.
11115514 2001 Intracellular redistribution of nucleolin upon interaction with the CD3epsilon chain of the T cell receptor complex.
10983978 2000 Direct coupling of transcription and mRNA processing through the thermogenic coactivator PGC-1.
10660576 2000 Nucleolin, a novel partner for the Myb transcription factor family that regulates their activity.
10503877 1999 In vivo interaction of nucleophosmin/B23 and protein C23 during cell cycle progression in HeLa cells.
10393184 1999 A novel RNA polymerase II-containing complex potentiates Tat-enhanced HIV-1 transcription.
9918513 1998 Nucleolin: a multifunctional major nucleolar phosphoprotein.
9822633 1998 Cellular adhesion mediated by factor J, a complement inhibitor. Evidence for nucleolin involvement.
9512561 1998 Interaction between the N-terminus of human topoisomerase I and SV40 large T antigen.
9388266 1997 Nucleolin is a protein kinase C-zeta substrate. Connection between cell surface signaling and nucleus in PC12 cells.
8663258 1996 The physical association of casein kinase 2 with nucleolin.
8620867 1996 C23 interacts with B23, a putative nucleolar-localization-signal-binding protein.
8567649 1996 Identification of a nucleolin binding site in human topoisomerase I.
8530516 1995 A fraction enriched in a novel glucocorticoid receptor-interacting protein stimulates receptor-dependent transcription in vitro.
8321232 1993 Nuclear proteins that bind the pre-mRNA 3' splice site sequence r(UUAG/G) and the human telomeric DNA sequence d(TTAGGG)n.
8065311 1994 U20, a novel small nucleolar RNA, is encoded in an intron of the nucleolin gene in mammals.
7993898 1994 Major cell surface-located protein substrates of an ecto-protein kinase are homologs of known nuclear proteins.
7718615 1995 Purification and partial amino acid sequencing of a fructosyllysine-specific binding protein from cell membranes of the monocyte-like cell line U937.
7642087 1995 Human DNA helicase IV is nucleolin, an RNA helicase modulated by phosphorylation.
3409881 1988 A major nucleolar protein, nucleolin, induces chromatin decondensation by binding to histone H1.
2737305 1989 Cloning and sequencing of the human nucleolin cDNA.
2394707 1990 Genomic organization and chromosomal localization of the human nucleolin gene.
1860869 1991 Granzyme A binding to target cell proteins. Granzyme A binds to and cleaves nucleolin in vitro.