Property Summary

NCBI Gene PubMed Count 24
PubMed Score 14.92
PubTator Score 223.72

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma -1.300 8.0e-08
group 4 medulloblastoma -1.300 1.4e-05
medulloblastoma, large-cell -1.600 1.3e-04
lung cancer 1.200 7.2e-04
subependymal giant cell astrocytoma -1.686 7.1e-03

Gene RIF (11)

PMID Text
24340049 findings suggest that SPIN90 contributes to the formation and movement of endosomal vesicles, and modulates the stability of EGFR protein, which affects cell cycle progression
23765104 SPIN90 dephosphorylation is a prerequisite step for releasing cofilin so that cofilin can adequately sever actin filaments into monomeric form.
23342115 Findings show that SPIN90 modulates synaptic activity in neurons as a result of its phosphorylation.
23024796 Dia2 and DIP co-tether to nascent blebs and this linkage is required for bleb formation.
22082156 Knockdown of NCK interacting protein with SH3 domain (NCKIPSD) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
19460367 SPIN90 and IRSp53 positively cooperated to mediate Rac activation, and co-expression of SPIN90 and IRSp53 in COS-7 cells led to the complex formation of SPIN90-IRSp53 in the leading edge of cells
17537434 The interplay between palladin, SPIN90 and Src and characterized the role of palladin and SPIN90 in platelet derived growth factor and Src-induced cytoskeletal remodeling, was analyzed.
17398099 DIP binds to and inhibits actin assembly by the FH2 domain of the formin mDia2
17398099 These observations point to a pivotal role for DIP in the control of nonbranched and branched actin-filament assembly that is mediated by Diaphanous-related formins and activators of Arp2/3, respectively.
16253999 SPIN90 participates in reorganization of the actin cytoskeleton and in actin-based cell motility
14559906 the interaction of the betaPIX.WASP.SPIN90 complex with Nck is crucial for stable cell adhesion and can be dynamically modulated by SPIN90 phosphorylation that is dependent on cell adhesion and ERK activation

AA Sequence

MYRALYAFRSAEPNALAFAAGETFLVLERSSAHWWLAARARSGETGYVPPAYLRRLQGLEQDVLQAIDRA      1 - 70
IEAVHNTAMRDGGKYSLEQRGVLQKLIHHRKETLSRRGPSASSVAVMTSSTSDHHLDAAAARQPNGVCRA     71 - 140
GFERQHSLPSSEHLGADGGLYQIPLPSSQIPPQPRRAAPTTPPPPVKRRDREALMASGSGGHNTMPSGGN    141 - 210
SVSSGSSVSSTSLDTLYTSSSPSEPGSSCSPTPPPVPRRGTHTTVSQVQPPPSKASAPEPPAEEEVATGT    211 - 280
TSASDDLEALGTLSLGTTEEKAAAEAAVPRTIGAELMELVRRNTGLSHELCRVAIGIIVGHIQASVPASS    281 - 350
PVMEQVLLSLVEGKDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALYEDEGVIRCYLEELLHI    351 - 420
LTDADPEVCKKMCKRNEFESVLALVAYYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARD    421 - 490
MQTDTQDHQKLCYSALILAMVFSMGEAVPYAHYEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLA    491 - 560
LNLHLPAADQNVIMAALSKHANVKIFSEKLLLLLNRGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAI    561 - 630
FYHTDMMALIDITVRHIADLSPGDKLRMEYLSLMHAIVRTTPYLQHRHRLPDLQAILRRILNEEETSPQC    631 - 700
QMDRMIVREMCKEFLVLGEAPS                                                    701 - 722
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24340049 2013 SPIN90 knockdown attenuates the formation and movement of endosomal vesicles in the early stages of epidermal growth factor receptor endocytosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23765104 2013 SPIN90 dephosphorylation is required for cofilin-mediated actin depolymerization in NMDA-stimulated hippocampal neurons.
23342115 2013 SPIN90 phosphorylation modulates spine structure and synaptic function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23024796 2012 Dia-interacting protein (DIP) imposes migratory plasticity in mDia2-dependent tumor cells in three-dimensional matrices.
22419821 2012 Identification of IGPR-1 as a novel adhesion molecule involved in angiogenesis.
21269460 2011 Initial characterization of the human central proteome.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19460367 2009 SPIN90-IRSp53 complex participates in Rac-induced membrane ruffling.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
18088087 2008 Phosphoproteome of resting human platelets.
17537434 2007 Palladin interacts with SH3 domains of SPIN90 and Src and is required for Src-induced cytoskeletal remodeling.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17398099 2007 Dia-interacting protein modulates formin-mediated actin assembly at the cell cortex.
16999739 2006 Interaction of SPIN90 with syndapin is implicated in clathrin-mediated endocytic pathway in fibroblasts.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16253999 2006 Interaction of SPIN90 with the Arp2/3 complex mediates lamellipodia and actin comet tail formation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15095401 2004 Identification of FHOD1-binding proteins and mechanisms of FHOD1-regulated actin dynamics.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559906 2003 Regulation of SPIN90 phosphorylation and interaction with Nck by ERK and cell adhesion.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11509578 2001 mDia-interacting protein acts downstream of Rho-mDia and modifies Src activation and stress fiber formation.
11278500 2001 SPIN90 (SH3 protein interacting with Nck, 90 kDa), an adaptor protein that is developmentally regulated during cardiac myocyte differentiation.
11241789 2001 Genomic organization, tissue expression, and cellular localization of AF3p21, a fusion partner of MLL in therapy-related leukemia.
11157975 2001 A novel neural Wiskott-Aldrich syndrome protein (N-WASP) binding protein, WISH, induces Arp2/3 complex activation independent of Cdc42.
10648423 2000 Novel SH3 protein encoded by the AF3p21 gene is fused to the mixed lineage leukemia protein in a therapy-related leukemia with t(3;11) (p21;q23).
10619843 2000 The VacA toxin of Helicobacter pylori identifies a new intermediate filament-interacting protein.