Property Summary

NCBI Gene PubMed Count 67
PubMed Score 36.42
PubTator Score 32.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Albuminuria 21 0.0 0.0
Nephrotic Syndrome 78 0.0 0.0
Proteinuria 144 0.0 0.0
Disease Target Count P-value
glioblastoma 5792 1.1e-03
ovarian cancer 8520 2.9e-03
osteosarcoma 7950 5.4e-03
Breast cancer 3578 2.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Low tension glaucoma 7 3.527 1.8
Craniofrontonasal syndrome 13 3.398 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 2.800 2.4e-02
glioblastoma 1.100 1.1e-03
osteosarcoma -1.020 5.4e-03
ovarian cancer 1.200 2.9e-03

Gene RIF (26)

AA Sequence

MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKNSLKKGSLVKN      1 - 70
LKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKFAYVAEREDELSLVKGSRVTV     71 - 140
MEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFLSLRKGASLSNGQGSRVLHVVQTLYPFSSVT    141 - 210
EEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRF    211 - 280
AGREWYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFH    281 - 350
TMDELVEHYKKAPIFTSEHGEKLYLVRALQ                                            351 - 380
//

Text Mined References (74)

PMID Year Title