Property Summary

NCBI Gene PubMed Count 114
PubMed Score 195.38
PubTator Score 154.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma -2.518 8.1e-03
glioblastoma 2.400 4.1e-03
cystic fibrosis 1.122 1.7e-05
non-small cell lung cancer -1.975 6.4e-18
intraductal papillary-mucinous adenoma (... -1.600 6.1e-04
intraductal papillary-mucinous carcinoma... -1.500 1.7e-03
lung cancer -4.200 4.3e-05
pancreatic cancer 1.200 6.8e-03
diabetes mellitus -1.400 2.3e-02
interstitial cystitis 2.200 1.2e-04
pediatric high grade glioma 1.400 1.5e-03
posterior fossa group A ependymoma 1.100 1.1e-04
lung adenocarcinoma -1.600 6.7e-07
invasive ductal carcinoma 1.807 3.2e-04
inflammatory breast cancer 1.300 3.7e-03
lung carcinoma -3.700 2.1e-30
mucosa-associated lymphoid tissue lympho... 2.479 6.1e-03
ulcerative colitis 3.000 3.6e-06
ovarian cancer -1.800 1.3e-05

Protein-protein Interaction (12)

Gene RIF (69)

PMID Text
26272171 A novel homozygous mutation in NCF2.
26160850 results reveal an essential role for the Cys-Gly-Cys triad in Nox2 in binding p67(phox), seconded by an additional binding region, comprising residues C terminal to Cys-Gly-Cys. The 2 regions interact with distinct partner sites in p67(phox).
25795782 This model assigns a central role to Arg-395 in the structure and stability of the quaternary NCF2/NCF4/VAV1/RAC1 NADPH oxidase complex.
25056956 Data indicate that arachidonic acid induces the direct interaction of Rac-GTP-bound p67(phox) with the C-terminal cytosolic region of phagocyte NADPH oxidase Nox2.
24596025 Four novel mutations in the NCF1, NCF2, and CYBB genees have been identified in chronic granulomatous disease patients in Morocco.
24163247 Results not only establish allelic heterogeneity within NCF2 associated with SLE, but also emphasize the utility of multi-ethnic cohorts to identify predisposing variants explaining additional phenotypic variance of complex diseases like SLE.
24162774 HIV-1 gp120 downregulates the expression of neutrophil cytosolic factor 2 (NCF2) in human B cells
23821607 NCF2 in Asian populations shows a pattern of diversity characterized by a differentiated haplotype structure.
23264412 Case Report: report defects in NCF-2, teh gene encoding p67-phox, in four cases of chronic granulomatous disease.
23187810 Results provide insight into the redox-sensitive signaling mechanism that mediates cell survival involving p53 and its novel target NCF2/p67phox.
22562447 Eight novel mutations in CYBB and NCF2 genes were identified in patients with chronic granulomatous disease.
22203994 NCF2 is strongly associated with increased risk of childhood- and adult-onset systemic lupus erythematosus through a single nonsynonymous coding mutation (H389Q) in exon 12.
22046141 Association analysis identified five SLE susceptibility genes reaching genome-wide levels of significance : NCF2 ,IKZF1 ,IRF8 ,IFIH1 , and TYK2
21954286 p67(phox) has a critical role to support for reactive oxygen species production on the level of individual phagosomes.
21900546 This variant reduced binding of the NCF2 gene product p67(phox) to RAC2. This study found a novel genetic association of RAC2 with Crohn's disease (CD) and replicated the previously reported association of NCF4 with ileal CD.
21119665 High NCF2 expression in the cytoplasm is associated with uterine cervix carcinogenesis.
20842512 The genetic variation in the NCF2 gene was found to associate with SLE in US and European populations
20842512 Observational study of gene-disease association. (HuGE Navigator)
20679349 the extended activation domain of p67(phox) (amino acids 190-210) containing the D(Y/F)LGK motif plays an essential role in oxidase activation probably by interacting with gp91(phox).
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20375610 Here we show that p67(phox)adopts an elongated conformation when it exists not only as a monomer but also as the heterotrimer
20237496 Observational study of gene-disease association. (HuGE Navigator)
20167518 All mutations and some polymorphisms identified in the NCF2 gene in the autosomal forms of chronic granulomatous disease are listed. Review.
20074641 These findings identify the activation of PKC delta and NADPH oxidase as crucial steps in retinoic acid-induced neuroblastoma cell differentiation.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19953534 Alu-induced deletion of the TPR4 domain of p67-phox leads to loss of function and accelerated degradation of the protein.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19717732 Conclude that acute exercise increases intracellular NO in endothelial progenitor cells through an NADPH oxidase-inhibition mechanism in sedentary men.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19505917 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19439231 involved in insulin-stimulated O(2)(-) production in monocytes
19423540 Nine SNPs distributed across eight genetic regions (ALOX5, IRAK3, ITGB2, NCF2, NFKB1, SELP, SOD1, and STAT1) were associated with risk of glioma with P value of <0.01.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19423521 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19372141 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19116138 p67(phox)-SH3(N) specifically functions in gp91(phox)/Nox2 activation probably via facilitating oxidase assembly.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18625437 autosomal recessive CGD due to NCF-2 gene mutations, and a novel homozygous and hypomorphic NCF-2 gene mutation was found.
18546332 mutations in CYBB, NCF1, CYBA or NCF2 may play a role in chronic granulomatous disease
18424721 As(2)O(3) induced phosphorylation and membrane translocation of the NADPH oxidase subunit p47(phox) and it also increased translocation of Rac1 and p67(phox).
18029359 p40(phox) translocates p67(phox) to the region of the cytochrome and subsequently switches the oxidase to an activated state dependent upon PtdIns(3)P and SH3 domain engagement.
17910042 Single nucleotide polymorphism leads to alternative splicing without altering gene expression or respiratory burst activity.
17712795 a novel single nucleotide polymorphism in the promoter region
17703412 Observational study of gene-disease association. (HuGE Navigator)
17651608 There is an increased expression of NADPH oxidase p47(-PHOX) and p67(-PHOX) factor in idiopathic pulmonary fibrosis patients.
17462995 These data clearly identify PLAGL2 as a novel regulator of NCF2/p67phox gene expression as well as NADPH oxidase activity and contribute to a greater understanding of the transcriptional regulation of NCF2.
17060455 chemoattractant-stimulated superoxide production can be amplified by a positive feedback loop in which p67(phox) targets Vav1-mediated Rac activation
16987007 NADPH oxidase assembly from p67phox was studies at the single-cell level.
16626305 These results indicate that Hcy (homocysteine)-stimulated superoxide anion production in monocytes is regulated through PKC-dependent phosphorylation of p47phox and p67phox subunits of NADPH oxidase.
16608528 Observational study of gene-disease association. (HuGE Navigator)
16310324 Expression of p67(phox) is regulated through mechanisms that include modulation of transcription and translation.
16297854 Here we show that the p47(phox)-p67(phox) interaction is disrupted not only by deletion of the PRR but also by substitution for basic residues in the extra-PRR (K383E/K385E).
16293794 Increased expression and activity of NAD(P)H oxidase subunits and xanthine oxidase, in part mediated through angiotensin II and PKC-dependent pathways, are important mechanisms underlying increased oxidative stress in human coronary artery disease
15256399 NAD(P)H oxidase activity is associated with increased protein levels of p22phox, p47phox, and p67phox, and increased p22phox and nox2 (gp91phox) mRNA expression.
15181005 NOXO1, p47phox, and p67phox regulate Nox3
12719414 p67phox and p47phox have roles in regulating a change of conformation in cytochrome b558, which initiates the electron transfer in NADPH oxidase activation
12130503 NAD(P)H oxidase subunits p47(phox) and p67(phox) are expressed in platelets; and NAD(P)H oxidase-dependent platelet superoxide anion release increases platelet recruitment.
12101222 effect of cPLA2 on its translocation
11929750 Val204 in p67(phox), previously shown to be required for NADPH oxidase activity under cell-free conditions, was found to be essential for superoxide production by intact COS-phox cells.
11893732 p22(phox), gp91(phox), p47(phox), p67(phox), and p40(phox) existed as a functional complex in the cytoskeletal fraction.
11796733 detailed study of the protein-protein interactions that occur in the p40-p47-p67(phox) complex of the resting oxidase
11705402 In a cell-free system, covalent binding between C-terminal-truncated p67phox and rac in the correct fusion order produces a more stable complex than the individual components and significantly influences the duration of fusion-produced oxidase activation.
11483614 Transcriptional regulation of the p67phox gene: role of AP-1 in concert with myeloid-specific transcription factors. Identification of cis-regulatory elements regulating p67(phox), with identification of specific sequences of TF binding sites.

AA Sequence

MSLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHL      1 - 70
AVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKA     71 - 140
EEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGKLFRPNERQVAQLAKKDYLGKATVVASVVD    141 - 210
QDSFSGFAPLQPQAAEPPPRPKTPEIFRALEGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATV    211 - 280
MFNGQKGLVPCNYLEPVELRIHPQQQPQEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPM    281 - 350
PYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDSMKDAWGQVKNY    351 - 420
CLTLWCENTVGDQGFPDEPKESEKADANNQTTEPQLKKGSQVEALFSYEATQPEDLEFQEGDIILVLSKV    421 - 490
NEEWLEGECKGKVGIFPKVFVEDCATTDLESTRREV                                      491 - 526
//

Text Mined References (120)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26272171 2015 A novel mutation in NCF2 associated with autoimmune disease and a solitary late-onset infection.
26160850 2015 A Cys-Gly-Cys triad in the dehydrogenase region of Nox2 plays a key role in the interaction with p67phox.
25795782 2015 Systemic lupus erythematosus-associated neutrophil cytosolic factor 2 mutation affects the structure of NADPH oxidase complex.
25416956 2014 A proteome-scale map of the human interactome network.
25056956 2014 Arachidonic acid induces direct interaction of the p67(phox)-Rac complex with the phagocyte oxidase Nox2, leading to superoxide production.
24596025 2014 Chronic granulomatous disease in Morocco: genetic, immunological, and clinical features of 12 patients from 10 kindreds.
24163247 2014 Allelic heterogeneity in NCF2 associated with systemic lupus erythematosus (SLE) susceptibility across four ethnic populations.
23910690 2013 Clinical, functional, and genetic characterization of chronic granulomatous disease in 89 Turkish patients.
23821607 2013 Evolutionary dynamics of the human NADPH oxidase genes CYBB, CYBA, NCF2, and NCF4: functional implications.
23264412 2012 Molecular analysis of four cases of chronic granulomatous disease caused by defects in NCF-2: the gene encoding the p67-phox.
23187810 2012 Identification of NCF2/p67phox as a novel p53 target gene.
22562447 2012 Clinical, functional and genetic analysis of twenty-four patients with chronic granulomatous disease - identification of eight novel mutations in CYBB and NCF2 genes.
22203994 2012 Lupus-associated causal mutation in neutrophil cytosolic factor 2 (NCF2) brings unique insights to the structure and function of NADPH oxidase.
22046141 2011 Association of NCF2, IKZF1, IRF8, IFIH1, and TYK2 with systemic lupus erythematosus.
21954286 2012 Stable accumulation of p67phox at the phagosomal membrane and ROS production within the phagosome.
21900546 2012 NADPH oxidase complex and IBD candidate gene studies: identification of a rare variant in NCF2 that results in reduced binding to RAC2.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21119665 2011 Differential expression of ANXA6, HSP27, PRDX2, NCF2, and TPM4 during uterine cervix carcinogenesis: diagnostic and prognostic value.
20842512 2011 The association between single-nucleotide polymorphisms of NCF2 and systemic lupus erythematosus in Chinese mainland population.
20679349 2010 A conserved region between the TPR and activation domains of p67phox participates in activation of the phagocyte NADPH oxidase.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20375610 2009 The domain organization of p67 phox, a protein required for activation of the superoxide-producing NADPH oxidase in phagocytes.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20167518 2010 Hematologically important mutations: the autosomal recessive forms of chronic granulomatous disease (second update).
20074641 2010 PKC delta and NADPH oxidase in retinoic acid-induced neuroblastoma cell differentiation.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19953534 2010 Alu-repeat-induced deletions within the NCF2 gene causing p67-phox-deficient chronic granulomatous disease (CGD).
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19717732 2009 Effects of acute and chronic endurance exercise on intracellular nitric oxide in putative endothelial progenitor cells: role of NAPDH oxidase.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19624736 2009 Four different NCF2 mutations in six families from Turkey and an overview of NCF2 gene mutations.
19505917 2009 Lead exposure, polymorphisms in genes related to oxidative stress, and risk of adult brain tumors.
19439231 2009 Insulin-induced NADPH oxidase activation promotes proliferation and matrix metalloproteinase activation in monocytes/macrophages.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19423521 2009 Genetic polymorphisms in nitric oxide synthase genes modify the relationship between vegetable and fruit intake and risk of non-Hodgkin lymphoma.
19372141 2009 Candidate gene approach evaluates association between innate immunity genes and breast cancer risk in Korean women.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19129478 2009 A fluorescently tagged C-terminal fragment of p47phox detects NADPH oxidase dynamics during phagocytosis.
19116138 2009 Role for the first SH3 domain of p67phox in activation of superoxide-producing NADPH oxidases.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18625437 2008 Focus on FOCIS: the continuing diagnostic challenge of autosomal recessive chronic granulomatous disease.
18546332 2008 Molecular epidemiology of chronic granulomatous disease in a series of 80 kindreds: identification of 31 novel mutations.
18424721 2008 Inorganic arsenic activates reduced NADPH oxidase in human primary macrophages through a Rho kinase/p38 kinase pathway.
18029359 2008 Phosphatidylinositol 3-phosphate-dependent and -independent functions of p40phox in activation of the neutrophil NADPH oxidase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17910042 2008 New polymorphism in the NCF-2 gene leading to alternative splicing without altering gene expression or the respiratory burst activity.
17712795 2007 A single nucleotide polymorphism in the promoter region of theNCF-2 gene.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17651608 2007 [Increased expression of NADPH oxidase p47-PHOX and p67-PHOX factor in idiopathic pulmonary fibrosis].
17537988 2007 Role of NF-kappaB in transcriptional regulation of the phagocyte NADPH oxidase by tumor necrosis factor-alpha.
17462995 2007 Binding of pleomorphic adenoma gene-like 2 to the tumor necrosis factor (TNF)-alpha-responsive region of the NCF2 promoter regulates p67(phox) expression and NADPH oxidase activity.
17290225 2007 Full-length p40phox structure suggests a basis for regulation mechanism of its membrane binding.
17060455 2007 The Rac effector p67phox regulates phagocyte NADPH oxidase by stimulating Vav1 guanine nucleotide exchange activity.
16987007 Single-cell optical imaging of the phagocyte NADPH oxidase.
16937026 2006 Genetic and mutational heterogeneity of autosomal recessive chronic granulomatous disease in Tunisia.
16782902 2006 Activation state-dependent interaction between Galphai and p67phox.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16626305 2006 Homocysteine stimulates phosphorylation of NADPH oxidase p47phox and p67phox subunits in monocytes via protein kinase Cbeta activation.
16608528 2006 Genetic polymorphisms and susceptibility to lung disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16310324 2006 Variants of the 5'-untranslated region of human NCF2: expression and translational efficiency.
16297854 2005 A region C-terminal to the proline-rich core of p47phox regulates activation of the phagocyte NADPH oxidase by interacting with the C-terminal SH3 domain of p67phox.
16293794 2006 Coronary artery superoxide production and nox isoform expression in human coronary artery disease.
15657040 2005 Effects of p47phox C terminus phosphorylations on binding interactions with p40phox and p67phox. Structural and functional comparison of p40phox and p67phox SH3 domains.
15642721 2005 The arachidonic acid-binding protein S100A8/A9 promotes NADPH oxidase activation by interaction with p67phox and Rac-2.
15591124 2005 Protein kinase Cdelta regulates p67phox phosphorylation in human monocytes.
15513967 2005 Identification of a novel tumor necrosis factor alpha-responsive region in the NCF2 promoter.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15256399 2004 Systemic regulation of vascular NAD(P)H oxidase activity and nox isoform expression in human arteries and veins.
15181005 2004 Nox3 regulation by NOXO1, p47phox, and p67phox.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12887891 2003 PB1 domain-mediated heterodimerization in NADPH oxidase and signaling complexes of atypical protein kinase C with Par6 and p62.
12719414 2003 Changing the conformation state of cytochrome b558 initiates NADPH oxidase activation: MRP8/MRP14 regulation.
12716910 2003 Novel human homologues of p47phox and p67phox participate in activation of superoxide-producing NADPH oxidases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12207919 2002 Expression of a p67(phox) homolog in Caco-2 cells giving O(2)(-)-reconstituting ability to cytochrome b(558) together with recombinant p47(phox).
12169629 2002 Diverse recognition of non-PxxP peptide ligands by the SH3 domains from p67(phox), Grb2 and Pex13p.
12130503 2002 NAD(P)H oxidase-dependent platelet superoxide anion release increases platelet recruitment.
12121978 2002 A 29-kDa protein associated with p67phox expresses both peroxiredoxin and phospholipase A2 activity and enhances superoxide anion production by a cell-free system of NADPH oxidase activity.
12101222 2002 Cytosolic phospholipase A2 (cPLA2) regulation of human monocyte NADPH oxidase activity. cPLA2 affects translocation but not phosphorylation of p67(phox) and p47(phox).
11917128 2002 Assembly of the neutrophil respiratory burst oxidase: a direct interaction between p67PHOX and cytochrome b558 II.
11896062 2002 A prenylated p67phox-Rac1 chimera elicits NADPH-dependent superoxide production by phagocyte membranes in the absence of an activator and of p47phox: conversion of a pagan NADPH oxidase to monotheism.
11893732 2002 Intracellular localization and preassembly of the NADPH oxidase complex in cultured endothelial cells.
11796733 2002 Architecture of the p40-p47-p67phox complex in the resting state of the NADPH oxidase. A central role for p67phox.
11781392 2002 AP-1 is essential for p67(phox) promoter activity.
11733522 2002 Mapping of functional domains in the p22(phox) subunit of flavocytochrome b(559) participating in the assembly of the NADPH oxidase complex by "peptide walking".
11483614 2001 Transcriptional regulation of the p67phox gene: role of AP-1 in concert with myeloid-specific transcription factors.
11483497 2001 Novel modular domain PB1 recognizes PC motif to mediate functional protein-protein interactions.
11278853 2001 JFC1, a novel tandem C2 domain-containing protein associated with the leukocyte NADPH oxidase.
11112388 2000 Hematologically important mutations: the autosomal recessive forms of chronic granulomatous disease (first update).
11090627 2000 Structure of the TPR domain of p67phox in complex with Rac.GTP.
10672014 2000 Complementation of NADPH oxidase in p67-phox-deficient CGD patients p67-phox/p40-phox interaction.
10598813 1999 Autosomal recessive chronic granulomatous disease caused by novel mutations in NCF-2, the gene encoding the p67-phox component of phagocyte NADPH oxidase.
10498624 1999 Molecular characterization of autosomal recessive chronic granulomatous disease caused by a defect of the nicotinamide adenine dinucleotide phosphate (reduced form) oxidase component p67-phox.
10486263 1999 Rac1 disrupts p67phox/p40phox binding: a novel role for Rac in NADPH oxidase activation.
9642115 1998 Phagocyte NADPH oxidase p67-phox possesses a novel carboxylterminal binding site for the GTPases Rac2 and Cdc42.
9624165 1998 Cryptic Rac-binding and p21(Cdc42Hs/Rac)-activated kinase phosphorylation sites of NADPH oxidase component p67(phox).
9365277 1997 Cytosolic phox proteins interact with and regulate the assembly of coronin in neutrophils.
9255350 1997 [Signal transduction by Rac small G proteins in phagocytes].
9083043 1997 p40(phox) down-regulates NADPH oxidase activity through interactions with its SH3 domain.
9070911 1997 Identification of a double mutation (D160V-K161E) in the p67phox gene of a chronic granulomatous disease patient.
8975869 1996 Assembly of the phagocyte NADPH oxidase: molecular interaction of oxidase proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8748143 1995 NADPH oxidase and the respiratory burst.
8286749 1994 Autosomal recessive chronic granulomatous disease with absence of the 67-kD cytosolic NADPH oxidase component: identification of mutation and detection of carriers.
8257426 1993 Activation of NADPH oxidase of human neutrophils involves the phosphorylation and the translocation of cytosolic p67phox.
8036496 1994 Interaction of Rac with p67phox and regulation of phagocytic NADPH oxidase activity.
7938008 1994 Assembly of the phagocyte NADPH oxidase: binding of Src homology 3 domains to proline-rich targets.
7903171 1993 Characterization of the p67phox gene: genomic organization and restriction fragment length polymorphism analysis for prenatal diagnosis in chronic granulomatous disease.
7738010 1995 A 68-kDa kinase and NADPH oxidase component p67phox are targets for Cdc42Hs and Rac1 in neutrophils.
2393022 1990 Genes for two autosomal recessive forms of chronic granulomatous disease assigned to 1q25 (NCF2) and 7q11.23 (NCF1).
1979859 1990 A HindIII polymorphism in the human NCF2 gene.
1692159 1990 Cloning of a 67-kD neutrophil oxidase factor with similarity to a noncatalytic region of p60c-src.