Property Summary

NCBI Gene PubMed Count 15
PubMed Score 13.90
PubTator Score 6.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.400 1.2e-03
ependymoma -3.000 6.8e-24
oligodendroglioma -2.400 6.2e-19
glioblastoma -2.500 9.9e-11
sonic hedgehog group medulloblastoma -3.000 5.8e-11
atypical teratoid/rhabdoid tumor -2.600 4.5e-12
medulloblastoma, large-cell -2.500 1.7e-05
primitive neuroectodermal tumor -2.100 7.1e-05
adult high grade glioma -2.600 9.0e-08
pilocytic astrocytoma -1.900 3.0e-10
Pick disease -2.300 8.2e-04
invasive ductal carcinoma 1.200 7.7e-03
pituitary cancer 1.300 2.3e-05

Gene RIF (5)

PMID Text
26048293 Schizophrenia subjects compared to controls showed a marked increase in CA1 hippocampal Norbin, and Tamalin proteins (47% and 34% respectively), which are endogenous regulators of mGluR5 signalling and trafficking
25916936 we demonstrate that neurochondrin has strong isoform selectivity towards the RIIa subunit of PKA with nanomolar affinity
23687301 In silico screening for palmitoyl substrates reveals a role for DHHC1/3/10 (zDHHC1/3/11)-mediated neurochondrin palmitoylation in its targeting to Rab5-positive endosomes.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
15790563 In mouse, the encoded protein is a negative regulator of Ca/calmodulin-dependent protein kinase II phosphorylation and is essential for the spatial learning process.

AA Sequence

MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDSEQFAALLLVTKAVKAGDIDA      1 - 70
KTRRRIFDAVGFTFPNRLLTTKEAPDGCPDHVLRALGVALLACFCSDPELAAHPQVLNKIPILSTFLTAR     71 - 140
GDPDDAARRSMIDDTYQCLTAVAGTPRGPRHLIAGGTVSALCQAYLGHGYGFDQALALLVGLLAAAETQC    141 - 210
WKEAEPDLLAVLRGLSEDFQKAEDASKFELCQLLPLFLPPTTVPPECYRDLQAGLARILGSKLSSWQRNP    211 - 280
ALKLAARLAHACGSDWIPAGSSGSKFLALLVNLACVEVRLALEETGTEVKEDVVTACYALMELGIQECTR    281 - 350
CEQSLLKEPQKVQLVSVMKEAIGAVIHYLLQVGSEKQKEPFVFASVRILGAWLAEETSSLRKEVCQLLPF    351 - 420
LVRYAKTLYEEAEEANDLSQQVANLAISPTTPGPTWPGDALRLLLPGWCHLTVEDGPREILIKEGAPSLL    421 - 490
CKYFLQQWELTSPGHDTSVLPDSVEIGLQTCCHIFLNLVVTAPGLIKRDACFTSLMNTLMTSLPALVQQQ    491 - 560
GRLLLAANVATLGLLMARLLSTSPALQGTPASRGFFAAAILFLSQSHVARATPGSDQAVLALSPEYEGIW    561 - 630
ADLQELWFLGMQAFTGCVPLLPWLAPAALRSRWPQELLQLLGSVSPNSVKPEMVAAYQGVLVELARANRL    631 - 700
CREAMRLQAGEETASHYRMAALEQCLSEP                                             701 - 729
//

Text Mined References (23)

PMID Year Title
26048293 2015 Metabotropic glutamate receptor 5, and its trafficking molecules Norbin and Tamalin, are increased in the CA1 hippocampal region of subjects with schizophrenia.
25916936 2015 Neurochondrin is an atypical RII?-specific A-kinase anchoring protein.
25416956 2014 A proteome-scale map of the human interactome network.
23687301 2013 In silico screening for palmitoyl substrates reveals a role for DHHC1/3/10 (zDHHC1/3/11)-mediated neurochondrin palmitoylation in its targeting to Rab5-positive endosomes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19946888 2010 Defining the membrane proteome of NK cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16945926 2006 Interaction of neurochondrin with the melanin-concentrating hormone receptor 1 interferes with G protein-coupled signal transduction but not agonist-mediated internalization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15790563 2005 Neurochondrin negatively regulates CaMKII phosphorylation, and nervous system-specific gene disruption results in epileptic seizure.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14559245 2003 Targeted disruption of the neurochondrin/norbin gene results in embryonic lethality.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11984006 2002 The Chediak-Higashi protein interacts with SNARE complex and signal transduction proteins.
11162505 2001 Semaphorin 4C, a transmembrane semaphorin, [corrected] associates with a neurite-outgrowth-related protein, SFAP75.
10684983 2000 Corrigendum to 'Molecular cloning and expression of human neurochondrin-1 and -2'(1).
10524216 1999 Molecular cloning and expression of human neurochondrin-1 and -2.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.