Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.48
PubTator Score 3.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 1.985 3.0e-05
adult high grade glioma 1.600 5.6e-05
atypical teratoid / rhabdoid tumor 1.300 1.5e-05
Breast cancer 1.300 6.9e-06
colon cancer 1.500 1.2e-03
Endometriosis 1.339 5.7e-03
gastric carcinoma 1.100 4.1e-02
glioblastoma 1.800 2.7e-09
group 3 medulloblastoma 2.500 8.4e-08
intraductal papillary-mucinous carcinoma... 1.600 3.4e-03
intraductal papillary-mucinous neoplasm ... 1.400 8.8e-03
invasive ductal carcinoma 1.100 3.3e-03
lung cancer 2.100 2.5e-03
medulloblastoma, large-cell 1.600 1.3e-05
non-small cell lung cancer 2.037 2.9e-23
osteosarcoma -1.584 1.7e-02
posterior fossa group A ependymoma 1.100 5.0e-06
primitive neuroectodermal tumor 1.500 9.2e-04
psoriasis -1.900 7.0e-05

Gene RIF (3)

AA Sequence

MEKRETFVQAVSKELVGEFLQFVQLDKEASDPFSLNELLDELSRKQKEELWQRLKNLLTDVLLESPVDGW      1 - 70
QVVEAQGEDNMETEHGSKMRKSIEIIYAITSVILASVSVINESENYEALLECVIILNGILYALPESERKL     71 - 140
QSSIQDLCVTWWEKGLPAKEDTGKTAFVMLLRRSLETKTGADVCRLWRIHQALYCFDYDLEESGEIKDML    141 - 210
LECFININYIKKEEGRRFLSCLFNWNINFIKMIHGTIKNQLQGLQKSLMVYIAEIYFRAWKKASGKILEA    211 - 280
IENDCIQDFMFHGIHLPRRSPVHSKVREVLSYFHHQKKVRQGVEEMLYRLYKPILWRGLKARNSEVRSNA    281 - 350
ALLFVEAFPIRDPNLHAIEMDSEIQKQFEELYSLLEDPYPMVRSTGILGVCKITSKYWEMMPPTILIDLL    351 - 420
KKVTGELAFDTSSADVRCSVFKCLPMILDNKLSHPLLEQLLPALRYSLHDNSEKVRVAFVDMLLKIKAVR    421 - 490
AAKFWKICPMEHILVRLETDSRPVSRRLVSLIFNSFLPVNQPEEVWCERCVTLVQMNHAAARRFYQYAHE    491 - 560
HTACTNIAKLIHVIRHCLNACIQRAVREPPEDEEEEDGREKENVTVLDKTLSVNDVACMAGLLEIIVILW    561 - 630
KSIDRSMENNKEAKLYTINKFASVLPEYLKVFKDDRCKIPLFMLMSFMPASAVPPFSCGVISTLRSREEG    631 - 700
AVDKSYCTLLDCLCSWGQVGHILELVDNWLPTEHAQAKSNTASKGRVQIHDTRPVKPELALVYIEYLLTH    701 - 770
PKNRECLLSAPRKKLNHLLKALETSKADLESLLQTPGGKPRGFSEAAAPRAFGLHCRLSIHLQHKFCSEG    771 - 840
KVYLSMLEDTGFWLESKILSFIQDQEEDYLKLHRVIYQQIIQTYLTVCKDVVMVGLGDHQFQMQLLQRSL    841 - 910
GIMQTVKGFFYVSLLLDILKEITGSSLIQKTDSDEEVAMLLDTVQKVFQKMLECIARSFRKQPEEGLRLL    911 - 980
YSVQRPLHEFITAVQSRHTDTPVHRGVLSTLIAGPVVEISHQLRKVSDVEELTPPEHLSDLPPFSRCLIG    981 - 1050
IIIKSSNVVRSFLDELKACVASNDIEGIVCLTAAVHIILVINAGKHKSSKVREVAATVHRKLKTFMEITL   1051 - 1120
EEDSIERFLYESSSRTLGELLNS                                                  1121 - 1143
//

Text Mined References (21)

PMID Year Title