Property Summary

NCBI Gene PubMed Count 23
PubMed Score 12.00
PubTator Score 14.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 1.300 1.7e-06
osteosarcoma -1.609 4.8e-03
posterior fossa group A ependymoma 1.400 1.0e-09
glioblastoma 2.200 7.7e-06
medulloblastoma 2.200 1.7e-07
atypical teratoid / rhabdoid tumor 2.100 6.4e-11
medulloblastoma, large-cell 2.900 1.6e-06
primitive neuroectodermal tumor 2.500 2.8e-07
adrenocortical carcinoma 1.441 9.6e-04
tuberculosis 1.200 7.5e-05
non-small cell lung cancer 2.019 1.5e-23
intraductal papillary-mucinous carcinoma... 1.200 2.0e-02
lung cancer 1.900 4.3e-05
pediatric high grade glioma 1.800 6.2e-07

Gene RIF (7)

PMID Text
25166511 Study has shown that both rs7311174 and rs2072374 in the NCAPD2 gene are associated with Parkinson's disease in a Han Chinese population.
21858164 Data show that that DNA repear process is dictated by PARP1 through its interaction with the chromosome-targeting domain of the hCAP-D2 subunit of condensin I.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20508983 Observational study of gene-disease association. (HuGE Navigator)
19454010 Interaction of HIV-1 Tat with CAPD2 in T-cells is identified by a proteomic strategy based on affinity chromatography coupled with mass spectrometry
18340469 Observational study of gene-disease association. (HuGE Navigator)
12138188 Data show the CNAP1 C-terminal region defines a novel histone-binding domain that is responsible for targeting CNAP1, and possibly condensin, to mitotic chromosomes.

AA Sequence

MAPQMYEFHLPLSPEELLKSGGVNQYVVQEVLSIKHLPPQLRAFQAAFRAQGPLAMLQHFDTIYSILHHF      1 - 70
RSIDPGLKEDTLQFLIKVVSRHSQELPAILDDTTLSGSDRNAHLNALKMNCYALIRLLESFETMASQTNL     71 - 140
VDLDLGGKGKKARTKAAHGFDWEEERQPILQLLTQLLQLDIRHLWNHSIIEEEFVSLVTGCCYRLLENPT    141 - 210
INHQKNRPTREAITHLLGVALTRYNHMLSATVKIIQMLQHFEHLAPVLVAAVSLWATDYGMKSIVGEIVR    211 - 280
EIGQKCPQELSRDPSGTKGFAAFLTELAERVPAILMSSMCILLDHLDGENYMMRNAVLAAMAEMVLQVLS    281 - 350
GDQLEAAARDTRDQFLDTLQAHGHDVNSFVRSRVLQLFTRIVQQKALPLTRFQAVVALAVGRLADKSVLV    351 - 420
CKNAIQLLASFLANNPFSCKLSDADLAGPLQKETQKLQEMRAQRRTAAASAVLDPEEEWEAMLPELKSTL    421 - 490
QQLLQLPQGEEEIPEQIANTETTEDVKGRIYQLLAKASYKKAIILTREATGHFQESEPFSHIDPEESEET    491 - 560
RLLNILGLIFKGPAASTQEKNPRESTGNMVTGQTVCKNKPNMSDPEESRGNDELVKQEMLVQYLQDAYSF    561 - 630
SRKITEAIGIISKMMYENTTTVVQEVIEFFVMVFQFGVPQALFGVRRMLPLIWSKEPGVREAVLNAYRQL    631 - 700
YLNPKGDSARAKAQALIQNLSLLLVDASVGTIQCLEEILCEFVQKDELKPAVTQLLWERATEKVACCPLE    701 - 770
RCSSVMLLGMMARGKPEIVGSNLDTLVSIGLDEKFPQDYRLAQQVCHAIANISDRRKPSLGKRHPPFRLP    771 - 840
QEHRLFERLRETVTKGFVHPDPLWIPFKEVAVTLIYQLAEGPEVICAQILQGCAKQALEKLEEKRTSQED    841 - 910
PKESPAMLPTFLLMNLLSLAGDVALQQLVHLEQAVSGELCRRRVLREEQEHKTKDPKEKNTSSETTMEEE    911 - 980
LGLVGATADDTEAELIRGICEMELLDGKQTLAAFVPLLLKVCNNPGLYSNPDLSAAASLALGKFCMISAT    981 - 1050
FCDSQLRLLFTMLEKSPLPIVRSNLMVATGDLAIRFPNLVDPWTPHLYARLRDPAQQVRKTAGLVMTHLI   1051 - 1120
LKDMVKVKGQVSEMAVLLIDPEPQIAALAKNFFNELSHKGNAIYNLLPDIISRLSDPELGVEEEPFHTIM   1121 - 1190
KQLLSYITKDKQTESLVEKLCQRFRTSRTERQQRDLAYCVSQLPLTERGLRKMLDNFDCFGDKLSDESIF   1191 - 1260
SAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSTGSRYQPLAS   1261 - 1330
TASDNDFVTPEPRRTTRRHPNTQQRASKKKPKVVFSSDESSEEDLSAEMTEDETPKKTTPILRASARRHR   1331 - 1400
S//

Text Mined References (35)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25166511 2014 Non-SMC condensin I complex, subunit D2 gene polymorphisms are associated with Parkinson's disease: a Han Chinese study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21858164 2011 Condensin I recruitment to base damage-enriched DNA lesions is modulated by PARP1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18340469 2008 Further examination of the candidate genes in chromosome 12p13 locus for late-onset Alzheimer disease.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17268547 2007 Reconstitution and subunit geometry of human condensin complexes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12138188 2002 Identification of a chromosome-targeting domain in the human condensin subunit CNAP1/hCAP-D2/Eg7.
11136719 2001 Chromosome condensation by a human condensin complex in Xenopus egg extracts.
10958694 2000 A human condensin complex containing hCAP-C-hCAP-E and CNAP1, a homolog of Xenopus XCAP-D2, colocalizes with phosphorylated histone H3 during the early stage of mitotic chromosome condensation.
10601332 1999 The A-kinase-anchoring protein AKAP95 is a multivalent protein with a key role in chromatin condensation at mitosis.
10101332 1999 Racial, ethnic, and gender diversity and the resident operative experience. How can the Academic Orthopaedic Society shape the future of orthopaedic surgery?
8590280 1995 Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1.