Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.97
PubTator Score 12.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -2.500 3.5e-07
glioblastoma multiforme -1.300 4.5e-27
osteosarcoma -1.014 3.5e-04
posterior fossa group A ependymoma -1.600 5.4e-07
sonic hedgehog group medulloblastoma -1.800 1.4e-04
medulloblastoma, large-cell -2.000 1.6e-06
primitive neuroectodermal tumor -1.100 5.3e-03
pilocytic astrocytoma 1.200 1.4e-05
lung carcinoma -2.000 3.0e-19

Gene RIF (8)

PMID Text
26611261 Abeta-dependent disruption of NCAM2 functions in Alzheimer's disease hippocampus contributes to synapse loss.
21300289 A complete structural model of the entire ectodomain of human NCAM2 has been assembled from crystal structures of six recombinant proteins corresponding to different regions of the ectodomain.
21214674 High NCAM2 is associated with increased 5-Fluorouracil sensitivity in prostate and breast cancer.
20932310 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20029409 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18706912 In the crystal structure, two Ig domains interact by domain swapping, as the two N-terminal beta-strands are interchanged.

AA Sequence

MSLLLSFYLLGLLVSSGQALLQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEKIISTQRVVVQ      1 - 70
KEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREVVSPQEFKQGEDAEVVCRVSS     71 - 140
SPAPAVSWLYHNEEVTTISDNRFAMLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPPA    141 - 210
ISMPQKSFNATAERGEEMTFSCRASGSPEPAISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPYV    211 - 280
CRATNKAGEDEKQAFLQVFVQPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSL    281 - 350
DGRIEVKGQHGSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSWEGNPINI    351 - 420
SCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYIL    421 - 490
ALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQTMVVLNNLE    491 - 560
PNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPILEYIVKY    561 - 630
RSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTLFNGLG    631 - 700
LGAVIGLGVAALLLILVVTDVSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGSKEPIV    701 - 770
EMRTEDERVTNHEDGSPVNEPNETTPLTEPEKLPLKEEDGKEALNPETIEIKVSNDIIQSKEDDSKA       771 - 837
//

Text Mined References (20)

PMID Year Title
26611261 2015 A?-dependent reduction of NCAM2-mediated synaptic adhesion contributes to synapse loss in Alzheimer's disease.
24962325 2014 Genome-wide survival analysis of age at onset of alcohol dependence in extended high-risk COGA families.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21552555 2011 A genome-wide association study on obesity and obesity-related traits.
21300289 2011 Structural model and trans-interaction of the entire ectodomain of the olfactory cell adhesion molecule.
21214674 2011 Neural cell adhesion molecule 2 as a target molecule for prostate and breast cancer gene therapy.
20932310 2010 Genome-wide association reveals genetic effects on human A?42 and ? protein levels in cerebrospinal fluids: a case control study.
20834067 2010 Joint influence of small-effect genetic variants on human longevity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20029409 2010 Association of polymorphisms in the SLIT2 axonal guidance gene with anger in suicide attempters.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18706912 2008 Crystal structure of the Ig1 domain of the neural cell adhesion molecule NCAM2 displays domain swapping.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146195 2004 Time-controlled transcardiac perfusion cross-linking for the study of protein interactions in complex tissues.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12538518 2003 Differential function of RNCAM isoforms in precise target selection of olfactory sensory neurons.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10830953 2000 The DNA sequence of human chromosome 21.
9226371 1997 Cloning of a novel human neural cell adhesion molecule gene (NCAM2) that maps to chromosome region 21q21 and is potentially involved in Down syndrome.