Property Summary

NCBI Gene PubMed Count 259
PubMed Score 3805.81
PubTator Score 2790.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (28)

Disease log2 FC p
gastric carcinoma -1.500 4.1e-02
interstitial lung disease 1.300 4.0e-02
malignant mesothelioma 1.700 5.6e-05
astrocytic glioma 1.800 5.1e-03
ependymoma 1.600 1.3e-02
oligodendroglioma 2.300 2.0e-03
glioblastoma -1.600 7.3e-04
osteosarcoma 1.477 1.2e-03
group 3 medulloblastoma -3.400 4.7e-05
atypical teratoid/rhabdoid tumor -3.500 2.8e-13
medulloblastoma, large-cell -2.900 4.6e-07
primitive neuroectodermal tumor -2.000 3.6e-05
tuberculosis 2.000 2.4e-05
intraductal papillary-mucinous adenoma (... -1.400 2.6e-04
intraductal papillary-mucinous neoplasm ... -1.300 5.0e-03
colon cancer -3.100 1.5e-05
lung cancer -1.200 2.0e-02
pediatric high grade glioma -1.500 1.0e-02
pilocytic astrocytoma 1.200 1.8e-02
subependymal giant cell astrocytoma -2.874 6.7e-03
lung carcinoma 3.600 1.0e-40
Breast cancer -2.700 4.1e-24
ductal carcinoma in situ -1.400 3.0e-04
invasive ductal carcinoma -1.400 2.0e-03
pituitary cancer 1.300 9.7e-05
Down syndrome 2.000 3.7e-04
type I diabetes mellitus -1.040 3.6e-02
psoriasis -1.700 9.2e-77

Gene RIF (229)

PMID Text
26856773 NK cell maturation to CD56(dim) subset associated with high levels of NCRs overrides the inhibitory effect of NKG2A and recovers impaired NK cell cytolytic potential after allogeneic hematopoietic stem cell transplantation.
26694817 The expression of coding and non-coding genes with SAFB1 cross-link sites was altered by SAFB1 knockdown. The isoform-specific expression of neural cell adhesion molecule (NCAM1) and ASTN2 was influenced by SAFB1.
26597998 study demonstrated the prognostic value of CD56 and CD117 in patients with newly diagnosed MM patients. Absence of both of them was associated with the poorest prognosis
26503236 Galectin 3 is most sensitive marker for malignancy, while loss of expression of CD56 is very specific for malignancy
26478212 L1-CAM and N-CAM: From Adhesion Proteins to Pharmacological Targets
26463893 NCAM1 deletion is associated with neuroblastoma and ganglioneuroma.
26460482 The neural cell adhesion molecule (NCAM) is a glycoprotein implicated in cell-cell adhesion, neurite outgrowth and synaptic plasticity.
26437631 A FOXP3(+)CD3(+)CD56(+)-expressed T-cell population with immunosuppressive function and reduced patient survival has been identified in cancer tissues of human hepatocellular carcinoma.
26391771 Letter/Case Report: CD56 positive diffuse large B cell lymphoma of the urinary bladder.
26344352 the expression of CD56 in adenomyosis is positively associated with the severity of dysmenorrhea.
26339384 CD56 marker is a useful alternative that is comparable to SSTR2A for the diagnosis of phosphaturic mesenchymal tumors.
26255203 Our findings demonstrate a novel Wnt/beta-catenin-miR-30a-5p-NCAM regulatory axis which plays important roles in controlling glioma cell invasion and tumorigenesis.
26186733 CD56 was negative in 96% of the primary malignant thyroid tumors while being expressed in the cytoplasm of 68.5% of the benign thyroid nodules.
26183877 CD56 expression remains to be a potentially unfavorable prognostic factor in acute promyelocytic leukemia patients.
26147745 this study shows that CD56 expression defines a poor prognosis subset in the cytogenetically intermediate prognosis pediatric AML.
26097548 for differential diagnosis of papillary thyroid cancer it was found that the only marker with both sensitivity and specificity above 90% was CD56 negativity
26087825 Renal graft CD56+ cell infiltrates were significantly associated with antibody mediated rejection.
26045862 CD56 could potentially become an adjunct diagnostic marker for ectomesenchymal chondromyxoid tumor instead of previously used CD57.
26039898 Results show significant increases in proportions of CD56+ T cells in relation to CMV infection in renal transplant patients and suggest that these cells have a cytotoxic function against CMV-infected cells.
26013700 Case Report: chronic lymphocytic leukemia with aberrant CD56 and CD57 expression.
25935537 Loss of CD56 expression is associated with extranodal NK/T cell lymphoma.
25924702 CD56 overexpression was associated with shorter OS.
25921109 Up-regulated level of serum sNCAM is associated with hepatic encephalopathy in hepatocelular carcinoma patients.
25889612 Aberrant NCAM expression plays a role in the pathogenesis of keratin producing odontogenic tumors.
25779340 Human BDCA2+CD123+CD56+ dendritic cells (DCs) related to blastic plasmacytoid dendritic cell neoplasm represent a unique myeloid DC subset.
25769453 Determining the P-glycoprotein expression and function of the peripheral blood CD56+ cells may help predict the MDR of NHL, thus has profound guiding significance for NHL treatment
25723856 CD56 is generally expressed in 70-80%11 of patients with MM, as observed in 69% of the t(14;16)-negative cases in this study. In contrast, none of the t(14;16)-positive cases showed CD56 positivity.
25628040 Low NCAM1 in the sera is associated with active forms of inflammatory bowel disease.
25619885 improvement in behavioral performance (open-field and grip-strength tests), as well as increased life-span was observed in rodents treated with NCAM-VEGF or NCAM-GDNF co-transfected cells
25596273 CD56(low)CD16(low) natural killer cells are multifunctional cells, and that the presence of hematologic malignancies affects their frequency and functional ability at both tumor site and in the periphery.
25445624 Results provide direct evidence for NCAM1 as a susceptibility gene for schizophrenia, which offers support to a neurodevelopmental model and neuronal connectivity hypothesis in the onset of schizophrenia
25363560 analysis of CD8+ T cell induction via Vgamma9gammadeltaT cell expansion by CD56(high+) Interferon-alpha-induced dendritic cells
25326085 Report ontogenic development of nerve fibers in human fetal livers using immunohistochemical detection of NCAM1/neurone-specific enolase expression.
25201755 Homophilic interaction between CD56 molecules may occur in tumor-cell recognition, leading to CIK-mediated cell death.
25188863 Report differential diagnosis of Primary cutaneous NK/T-cell lymphoma, nasal type and CD56-positive peripheral T-cell lymphoma.
25137309 results showed that NCAM1 might play an important role in the pathogenesis of autism
24909369 Increased frequency of ILT2-expressing CD56(dim)CD16(+) NK cells correlates with disease severity of pulmonary tuberculosis.
24807109 Women, w/ or w/o endometriosis, having larger populations of cytotoxic CD16(+) uterine NK cells and/or higher populations of NKp46(+)CD56(+) cells may be at greater risk of infertility resulting from inflammatory environment during implantation or later
24782118 CD56 positivity did not have any influence on the prognosis of these patients.
24726913 NCAM140 interacts with ufc1 and its trafficking and endocytosis is upregulated in the presense of Ufm1.
24715165 HBME-1, Galectin-3, Cytokeratin-19 and CD56 were used alone or in panels in a series of papillary thyroid carcinoma (PTC) and thyroid tumors of uncertain malignant potential.
24526449 NCAM expression in myelinating Schwann cells is indicative of early Schwann cell abnormalities.
24369228 CD56 can be expressed in normal immature granulocytes at a variety of expression levels in regenerative bone marrow. Attention should be paid when evaluating aberrant antigen expression of CD56 in granulocytes.
24365773 Expression of NCAM was associated with worsening hemodynamic parameters and major metabolic genes.
24349544 The described scFv has potential application in delivery of therapeutics to NCAM1-expressing cells in degenerated IVD.
24294395 Case Report: incidentally diagnosed CD56 positive diffuse large B-cell lymphoma.
24286519 Data indicate that the CD14bright/CD56+ monocyte subset is expanded in aging individuals as well as in patients with rheumatoid arthritis.
24240977 Decreased proportion of NK cells expressing CD56dim/CD16 antigens in Franconi anemia patients correlates with the impairment in the differentiation process of the NK cells and of the immune surveillance.
24206578 Positive CD56 expression was found in 23 APL patients.
24055371 Depletion of NCAM1(+) cells from human kidney epithelial cells abrogated stemness traits in vitro.
23960070 NCAM and dynein have roles in tethering dynamic microtubules and maintaining synaptic density in cortical neurons
23810283 High CD56 expression is associated with relapse in acute myeloid leukemia with t(8;21).
23716295 NCAM polysialylation in small cell lung cancer progression regulates substrate adherence potential.
23671285 translational modification of the neural cell adhesion molecule NCAM and the polysialyltransferase ST8SiaII in mammalian semen involves polysialic acid
23635388 CD56 and quantitative Ki-67 along with cytomorphology is a robust immunohistochemical panel to differentiate small cell lung carcinoma from other neuroendocrine neoplasms.
23557873 Results suggest that CD3+CD56+NKT cells do not play a role as a mediator in mental symptom such as depression in fibromyalgia syndrome patients.
23495921 Depletion of NCAM is one of the factors associated with or possibly responsible for disease progression in multiple sclerosis.
23480226 Women with age above 35 years and greater than 13% CD56 positive CD16 positive natural killer cells showed the highest risk of further pregnancy loss
23470050 We recommend immunohistochemical analyses for CD123, CD56 and CD4 inblastic plasmacytoid dendritic cell neoplasm patients, particularly in cases where the initial bone marrow study indicates normal morphology.
23462508 CD56(140kD) up-regulation plays a pivotal role in the pathogenesis of ischemic cardiomyopathy.
23418554 Data suggest that multi-antibody assay of TTF1, Vimentin, p63 CD56, chromogranin and synaptophysin may be of special value, especially in diagnosing small biopsies.
23365458 GATA2 is required for the maturation of human natural killer cells and the maintenance of the CD56(bright) pool in the periphery.
23303482 SNPs in NCAM1 were not significantly associated with heroin dependence.
23292839 the author showed that in cutaneous basal cell carcinoma, the expression of NCAM and c-KIT was high, PDGFRA was intermediate, and chromogranin A and synaptophysin was relatively low
23260340 Immunoblots revealed that depressed subjects displayed increased expression of PSA-NCAM.
23258197 An unknown factor with a molecular weight >100 kDa plays a critical role in the impairment of CD56(dim) natural killer cells in malignant pleural effusion, which might lead to tumor progression.
23061666 Data indicate that UCHL1 is a novel interaction partner of both NCAM isoforms that regulates their ubiquitination and intracellular trafficking.
23022470 In schizophrenia, abnormal PSA-NCAM and GAD67 expression may underlie the alterations observed in inhibitory neurotransmission.
23015367 Bioinformatic analysis of NCAM-associated expression profiles predicted a highly interactive protein network, which further implies potential molecular mechanisms underlying the metastatic processes of thyroid cancer
22792160 Intra-hepatic accumulation of the functionally impaired CXCR3(+)CD56Bright NK cell subset might be involved in HCV-induced liver fibrosis.
22732936 TGF-beta1 contributes to HCC-induced vascular alterations by affecting the interaction between HCC-StCs and Ld-MECs through a down-modulation of NCAM expression
22591692 CD56-positive T cells have a critical role in innate defense against HIV-1 infection.
22449227 NCAM1, SYPT and CGA expressions are differently regulated by neuroendocrine phenotype-specific transcription factors in lung cancer cells.
22423624 assessment of CD56 and CD117 expression by flow cytometry is a sensitive method for diagnostic evaluation of plasma cell neoplasms.
22384181 NCAM180 regulates Ric8A membrane localization and potentiates beta-adrenergic response
22384114 Cytotoxicity of CD56(bright) NK cells towards autologous activated CD4+ T cells is mediated through NKG2D, LFA-1 and TRAIL and dampened via CD94/NKG2A
22319021 results suggest that during differentiation CD56(bright) NK cells, similarly to mature activated NK cells, become highly cytotoxic and are relatively resistant to apoptosis induced by TNF family members.
22281821 NCAM and polySia are expressed and developmentally regulated in chick corneas. Both membrane-associated and soluble NCAM isoforms are expressed in chick corneas.
22276608 CD56 expression in B cell lymphoma is a rare occurrence.
22228741 Dehydroepiandrosterone increased PSA-NCAM expression and inhibited monocyte binding in an estrogen- and androgen receptor-dependent manner.
22219127 Cerebrospinal fluid NCAM-1 is a potential biomarker for drug-effective epilepsy and drug-refractory epilepsy.
22211388 Prominent CD56 expression by damaged and regenerating muscle fibers in the skin.
22099865 This study demonistrated that the depressed patients showed decreases in PSA-NCAM expression in the basolateral and basomedial amygdala and in the lateral nucleus of bipolar patients
22085395 Serum NCAM is hyposialylated in hereditary inclusion body myopathy.
22081445 The CD56 antigen is an independent prognostic risk factor in patients with acute myeloid leukemia
22001684 Multiple sclerosis is characterized by a dysregulation of CD8+CD56-perforin+ T cells that may play a role in the development of disability.
21940794 Together, these data indicate that polysialic acid regulates cell motility through NCAM-induced but FGF-receptor-independent signalling to focal adhesions
21739604 These results point to NCAM-mediated stimulation of FGFR as a novel mechanism underlying epithelial ovarian carcinoma malignancy and indicate that this interplay may represent a valuable therapeutic target.
21717310 CD56 expression is associated with neuroectodermal differentiation in ameloblastomas.
21691800 NCAM-140 interacts with APP, potentially playing a role in neurite outgrowth and neural development.
21669487 Soluble NCAM status was a significant independent factor predictive of long-term survival in patients with hepatocellular carcinoma
21666061 Natural killer (NK)-92 cell line retains the functional characteristics of the CD56(bright) NK cell subset; consequently, gene silencing of CD56 profoundly inhibits the ability of NK-92 cells to kill activated syngeneic T cells.
21577011 This study did not support the ncam1 is direct modulation of these genes on temperament
21515372 Abnormal synaptic innervation in transgenic mice expressing the NCAM extracellular proteolytic cleavage fragment impairs prefrontal cortex plasticity and alters working memory.
21467162 Excellent prognosis in a subset of patients with ewing sarcoma identified at diagnosis by CD56 using flow cytometry.
21464126 STX(G421A) shows a dramatic decrease in polySia synthetic activity on NCAM, whereas STX(C621G) does not; polySia shows a dopamine (DA) binding activity
21457956 Maturation of follicles is accompanied by a decrease in CD56+CD16+ natural killer cells that may have deleterious effects on follicular maturation.
21239711 CD56(bright)CD11c(positive) cells play a key role in the interleukin (IL)-18-mediated proliferation of gammadelta T cells.
21212386 Genetic variation in NCAM1 contributes to left ventricular wall thickness in hypertensive families.
21178331 CD6 expression on peripheral NK cells marks a novel CD56(dim) subpopulation associated with distinct patterns of cytokine and chemokine secretion.
21148082 CD56 expression is associated with coexpression of immaturity-associated and T-cell antigens and is an independent adverse prognostic factor for relapse in acute promyelocytic leukemia treated with all-trans retinoic acid and anthracycline-based regimens
21115007 Data suggest that the intra-cellular part of NCAM inhibits cis-dimerization, an effect mainly dependent on the palmitoylation sites.
20932956 PSA-NCAM may modulate the functional interaction between BDNF and its high and low affinity receptors;possible clinical significance of neuronal trophism in cerebellar neurodegenerative disorders
20875069 CD56 expression in odontogenic epithelium is highly suggestive of ameloblastoma and can help in differentiating this from odontogenic keratocyst
20805222 Sequences from the first fibronectin type III repeat of the neural cell adhesion molecule allow O-glycan polysialylation of an adhesion molecule chimera.
20733159 assessed the transcriptional, phenotypic, and functional differences between CD57(+) and CD57(-) NK cells within the CD56(dim) mature NK subset
20696944 CD56(dim) NK cells continue to differentiate. During this process, they lose expression of NKG2A, sequentially acquire inhibitory killer cell inhibitory immunoglobulin-like receptors and CD57.
20684989 Results confirm the favorable impact of NPM1 mutations and identify the adverse prognostic relevance of CD56 expression in this subgroup of AML.
20664990 Assessment of natural killer-like T CD3+/CD16+ CD56+ cells may be helpful in determining a worsening of clinical course in chronic lymphocytic leukemia.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20610389 a decisive role for the neuronal K(+) channel in regulating NCAM-dependent neurite outgrowth and attribute a physiologically meaningful role to the functional interplay of Kir3.3, NCAM, and TrkB in ontogeny
20557674 The predominance of extranodal involvement in our series may be associated with the adhesion-related function of CD56. A high frequency of bcl-6 expression may be associated with a more favorable clinical course and prognosis.
20538416 CD56 cannot be used as a supplementary tool in the differential diagnosis of non-neoplastic biliary diseases in needle biopsies.
20524836 we confirmed the expression of NCAM in Wilms tumors, nephrogenic rests, and metanephric mesenchyme and its early derivatives in fetal renal cortex
20483466 This study suggested that SNP variants in NCAM1 may impact on related traits, particularly by mediating inhibition of aggressiveness.
20483466 Observational study of gene-disease association. (HuGE Navigator)
20414008 analysis of the effect of human colorectal carcinogenesis on the neural cell adhesion molecule expression and polysialylation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20231901 SOCS-3 and PIAS-3 upregulation impairs IL-12-mediated interferon-gamma response in CD56 T cells in HCV-infected heroin users
20187302 we suggest NCAM as a marker for the WT progenitor cell population. These findings provide novel insights into the cellular hierarchy of WT, having possible implications for future therapeutic options
20164549 This study suggested a potential involvement of NCAM expressing neurons in the cognitive deficits in Alzheimer's disease.
20083228 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20059553 NCAM in the amygdala mediates consolidation of auditory fear conditioning; increased NCAM transgene expression in the amygdala is among the mechanisms whereby stress facilitates fear conditioning processes in floxed mice.
20049565 induction of SOX4 gene expression might be responsible for the CD56 expression in human myeloma cells
20029409 Observational study of gene-disease association. (HuGE Navigator)
20027291 The IL-23 induced cytokines allow for the subsequent production of IL-12 and amplify the IFN-gamma production in the type-1 cytokine pathway.
20015889 Neural cell adhesion molecules expressed on mesenchymal stem cells play a crucial role in the human hematopoiesis-supporting ability of the cell line.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19897577 human CD56(bright) NK cells progress through a continuum of differentiation that ends with a CD94(low)CD56(dim) phenotype.
19864234 CD56 immunohistochemical analysis is useful for detecting residual plasma cell myeloma particularly in morphologically equivocal cases in which light chain restriction cannot be demonstrated, and may serve as a potential response criterion.
19788615 Mucosal remodeling with alterations of NCAM+ or alpha-SMA+ subepithelial and interstitial cells may play a critical role in UC-associated tumorigenesis.
19788570 results suggest a positive role of NCAM in neurogenesis in the periventricular region; expression of NCAM in stem cells might be one of many factors useful for therapeutic approaches in the future
19772585 Expression defines a committed T-lymphocyte lineage to the cytotoxic phenotype
19725832 polysialylated NCAM persistence, up-regulated polysialyltransferase-1 mRNA and previously uncovered defective myelin-associated glycoprotein may be early pathogenetic events in adult-onset autosomal-dominant leukodystrophy
19724850 Class III beta-tubulin and NCAM were expressed in 50 and 68% of basal cell carcinoma
19652998 Additional immunohistochemical detection of neuroendocrine differentiation (chromogranin-A, synaptophysin, and neural-cell adhesion molecule) in non-small cell lung cancer is presently not of prognostic importance.
19587433 Structural change in NCAM1 caused by point mutation may be the reason for astrocytoma tumorigenesis.
19507465 The role of NCAM in cell differentiation, survival and plasticity suggests an involvement in the development process of the carotid body and in cellular/molecular changes due to chronic hypoxia.
19411161 This data suggests NCAM-180 mRNA expression is altered in a regionally-specific manner in schizophrenia and these changes are associated with the early period following diagnosis.
19393299 study implicates the major NCAM isoforms, PSA-NCAM and proteolytically cleaved NCAM in pre- and postnatal development of the human prefrontal cortex
19328558 Observational study of gene-disease association. (HuGE Navigator)
19328310 Subcutaneous panniculitis-like T-cell lymphoma with a phenotype showing a deficiency of cd56.
19235015 propose four potential activators of the CD56 promoter and for CD56 to be involved in proliferation and anti-apoptosis, leading to disease progression in multiple myeloma
19222860 NCAM-positive neuroblastoma patients had more often metastases at diagnosis, and NCAM expression associated with advanced disease
19153015 CD56 is extremely useful in the diagnosis of papillary thyroid carcinoma
19086053 Observational study of gene-disease association. (HuGE Navigator)
18990213 The results obtained show that, in man, the expression of PSA-NCAM in selective populations of central and peripheral neurons occurs not only during prenatal life, but also in adulthood.
18979395 N-CAM increased in cytotrophoblasts and decreased in extravillous trophoblasts and decidual cells of preeclamptic subjects.
18972120 NCAM represents a marker for neuroblastomas irrespectively of their stages
18828801 NCAM1 exon 12 markers are significant for specific haplotypes in a family sample of comorbid alcohol and drug dependence.
18828801 Observational study of gene-disease association. (HuGE Navigator)
18755075 To identify the gene regulated by PKD2 and c-Myc, we performed gene expression profiling in PKD2 and c-Myc overexpressing cells. NCAM is an important molecule in the cystogenesis induced by PKD2 overexpression.
18641363 CD56(bright) NK cells postallogeneic hematopoietic stem cell transplantation exhibit peculiar phenotypic and functional properties
18628406 Immunological events associated with the luteinizing hormone surge induce alterations in all subsets of CD56(+) cells in the fertile menstrual cycle
18601968 No genetic association between NCAM1 gene polymorphisms and schizophrenia in the Chinese population.
18601968 Observational study of gene-disease association. (HuGE Navigator)
18594005 CD56-expressing gammadelta T lymphocytes are resistant to Fas ligand and chemically induced apoptosis
18462256 extramedullary relapse of MM is characterized by loss of CD56 expression
18432248 there was increased placental expression of NCAM (neural cell adhesion molecule) in small for gestational age cases
18425046 CD56 is often expressed by a wide variety of spindle cell sarcomas, thus, it has no value in differentiating GYN from non-GYN spindle cell tumors.
18384787 Enzymatic removal of PSA from NCAM or reduction of polysialyltransferase expression led to reduced association between NCAM and E-cadherin and subsequently increased E-cadherin-mediated cell-cell aggregation and reduced cell migration.
18368482 results provide evidence that the BCL motif is one of the multiple FGFR binding sites in NCAM
18353777 direct receptor-receptor interactions are not required for high affinity GDNF binding to NCAM but play an important role in the regulation of NCAM-mediated cell adhesion by GFRalpha1
18333845 relative frequency of CD19 and/or CD56 expression in acute myeloid leukemia (AML) with t(8;21) was significantly higher than those without this translocation and co-expression of these two antigens may serve as the surrogate markers for AML with t(8;21)
18323797 identified molecular characteristics of an aggressive subset of pediatric patients with AML through a prospective evaluation of CD56+ neural cell adhesion molecule (NCAM) and CD94 expression
18289872 Neural cell adhesion molecule-extracellular domain overexpression disrupts aborization of basket cells during the major period of axon/dendrite growth in transgenic mice.
18261743 NCAM-fibroblast growth factor receptor 1 interaction at the cell surface is likely to depend upon avidity effects due to receptor clustering
18231917 determined the clinical characteristics of 204 multiple myeloma (MM) patients and 26 plasma cell leukemia (PCL) patients with regard to CD56 expression.
18213713 Ganglioneuromas and ganglioneuroblastomas express the adhesive 120 kDa NCAM isoform, while neuroblastomas preferentially express the 180 kDa isoform classically involved in cell motility
18209097 Monitoring of T cells driven to senescence showed de novo induction of CD56, the prototypic receptor of NK cells.
17982624 NCAM expression may be used as a predictor of perineural invasion in adenoid cystic carcinoma
17971410 Ubiquitylation represents an endocytosis signal for NCAM.
17940597 that expansion of the CD56(bright) NK cell subtype in peripheral blood is not a hallmark of TAP deficiency, but can be found in other diseases as well
17900814 fetal forebrain axonal PSA-NCAM expression is inversely related to primary myelination
17891186 lack of CD56 expression on MM cells is not a prognostic marker in patients treated with high-dose chemotherapy, but is associated with t(11;14).
17878347 may explain the preferential accumulation of CD56(bright) NK cells often seen in environments rich in reactive oxygen species, such as at sites of chronic inflammation and in tumors
17761687 Observational study of gene-disease association. (HuGE Navigator)
17761687 association studies of alcohol dependence and 43 SNPs mapped to the gene cluster of NCAM1, TTC12, ANKK1 and DRD2
17683591 PSA-NCAM is not involved in masking Siglec-7
17635242 Although CD56 expression level varies among the cases, this molecule might play some roles in the manner of growth and expansion of CD56-positive B-cell lymphomas
17467233 PSA-NCAM is expressed in the human PFC neuropil following a laminated pattern and in a subpopulation of mature neurons, which lack doublecortin expression. Most of these cells have been identified as interneurons expressing calbindin
17431094 HIV-1 Nef protein up-regulates the ability of dendritic cellss to stimulate the immunoregulatory naturak killer cells.
17413444 Observational study of gene-disease association. (HuGE Navigator)
17413444 Single nucleotide polymorphisms within NCAM1 contribute differential risk for both bipolar disorder and schizophrenia possibly by alternative splicing of the gene.
17337466 Renal NCAM-expressing interstitial cells can participate in the initial phase of interstitial fibrosis.
17216340 The pattern of serum NCAM bands could be useful to detect brain tumor pathology. NCAM immunostaining of tumors was inversely correlated with the histological grade of malignancy. Loss of NCAM staining was significantly associated with poor prognosis.
17208489 GPI-anchored NCAM-120 suppressed rabies virus replication via induction of IFN-ss even though NCAM-120 was able to promote virus penetration into the cells.
17181871 Neuroblastoma cells resistant to anticancer drugs have increased invasive capacity caused by down-regulation of NCAM adhesion receptor.
17161382 In the "Europe only" stratum, there were nominally significant associations with five contiguous SNPs.
17085484 Observational study of gene-disease association. (HuGE Navigator)
17043020 NCAM1 along with RUNX1 is overexpressed during stress hematopoiesis in Down syndrome children and may contribute to the development of overt leukemia.
17005551 Co-immunoprecipitation and co-clustering paradigms were used to show that both NCAM and N-cadherin can interact with the 3Ig IIIC isoform of the FGFR1 in a number of cell types.
17003032 the FN1 alpha-helix is involved in an Ig5-FN1 interaction that is critical for the correct positioning of Ig5 N-glycans for polysialylation
16892559 Isolation of 3 novel isoforms of AML 1 (RUNX1) with different transactivating function, that might be a regulatory element of the NCAM (CD56) overexpression in chronic myocardial ischemia.
16690409 identified co-induction of NKG2A and CD56 on activation of TH2 cells
16627685 The gene expression profile of hepatic stem cells throughout life consists of high levels of expression of neuronal cell adhesion molecule (NCAM).
16572491 Tests whether activation and expansion of human NK cells with lipopolysaccharide (LPS) reveals differences between identical twins with regaard to C56 antigen.
16534119 NCAM is hyposialylated in hereditary inclusion body myopathy skeletal) muscle.
16406048 The new role of Neural Cell Adhesion Molecules in tumor neo-angiogenesis relevant for endothelial cell organization into capillary-like structures.
16316416 CD56(bright) and CD56(dim) human natural killer-cell subsets exert different functional and cytotoxic activities in response to a live bacterial pathogen.
16211277 NCAM is associated not only with a cell-to-cell adhesion mechanism, but also with tumorigenesis, including growth, development and perineural invasion in human salivary gland tumors
16172115 analysis of polymerization of polysialic acid on neural cell adhesion molecules
16027151 polysialyltransferase ST8Sia IV/PST recognizes specific amino acids in the first fibronectin type III repeat of the neural cell adhesion molecule
15950781 A significant increase was observed in PSA-NCAM, NCAM-180, NCAM-140, and HSP70 expression as seen by Western blotting and immunocytofluorescent studies in NMDA-treated cultures.
15782066 CD56 seems to be the most sensitive marker for the diagnosis of SCC of the uterine cervix
15626024 first pediatric case describing coexpression of CD56 on B-lineage acute lymphoblastic leukemia
15528382 CD56bright natural killer cells accumulate in inflammatory lesions and, in the appropriate cytokine environment, can engage with CD14+ monocytes in a reciprocal activatory fashion, thereby amplifying the inflammatory response.
15459479 There is a close relationship between PSA-NCAM expression and neuronal migration.
15356097 Pre-activated, adherent-natural killer cells express low levels of CD56 and CD161
15246157 Cells expressing this antigen repond to a Wilms tumor cell line feeder cells and are precursors of NK cells.
15231874 Unlike wild-type FGFR4, pituitary tumor derived-FGFR4 does not associate with neural cell-adhesion molecule (NCAM).
15223636 CD56 expression was associated with the leukemogenetic mutation at the primitive hematopoietic progenitor cell level
15061198 REVIEW: Prognostic significance of CD56 expressed in multiple myeloma
15050861 Observational study of gene-disease association. (HuGE Navigator)
15050861 genetic variations in neural cell adhesion molecule 1 or nearby genes could confer risks associated with bipolar affective disorder in Japanese individuals.
15006709 Alzheimer patients presented values of low molecular weight-NCAM and high molecular weight-NCAM significantly higher than healthy controls of similar age (higher than 130 kDa)
14959847 CD56 is expressed in bone marrow of acute myelogenous leukemias but not acute lymphoblastic leukemia
14726964 there are two types of CD56+ epithelial cells in the pancreatic duct system: CD56+ endocrine cells are numerous during the early stage of gestation while CD56+ luminal cells may represent developmental and regenerative changes of pancreatic ducts.
14688313 Natural killer (NK) cells expressing high CD56 levels are terminally differentiated cells identical to mature NK cells recently activated in the presence of IL-12, and not a functionally distinct subset or progenitors to mature CD56+low NK cells.
12937148 Strong overexpression of NCAM(CD56) and RUNX1(AML1) is a constant and characteristic feature of cardiomyocytes within or adjacent to scars in ICM.
12791681 which the polysialyltransferases bind to the first fibronectin type III repeat (FN1) of NCAM to polymerize polysialic acid chains on appropriately presented glycans in adjacent regions.
12727026 a useful immunohistochemical marker of Merkel cell carcinoma
12594840 Preferential apoptosis of CD56dim natural killer cell subset in patients with cancer.
12121226 CD56 molecules on NK cells interact with fibroblast growth factor receptor 1 on Jurkat T cells to trigger IL-2 production.
12008081 CD56 expression predicts occurrence of CNS disease in acute lymphoblastic leukemia but not CR or survival. CD56 may enable targeting of leukemic cells to tissues that express it.
12003861 PSA-NCAM was found to be expressed in the somata, dendrites and axonal processes of some neurons, which were identified as chandelier cell axon terminals (chandelier terminals), in the adult human entorhinal cortex and neocortex.
11915324 exists in lipid microdomains and transducts cell signalings via regulating the activation of signal transduction molecules
11820619 Significance of cell adhesion molecules, CD56/NCAM in particular, in human tumor growth and spreading.
11681838 NCAM 105-115 kDa is a protease- and neuraminidase-susceptible fragment and was correlated with ventricular enlargement in chronic schizophrenia (p = 0.01). Release of NCAM fragments in schizophrenia may be part of the pathogenic mechanism.

AA Sequence

MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRIS      1 - 70
VVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCD     71 - 140
VVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNV    141 - 210
PPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKN    211 - 280
DEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISS    281 - 350
EEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQG    351 - 420
PVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCT    421 - 490
AVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWY    491 - 560
DAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVQGEPSAPKLEGQMGEDGNSIKV    561 - 630
NLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVF    631 - 700
RTSAQPTAIPANGSPTSGLSTGAIVGILIVIFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGK    701 - 770
DMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAE    771 - 840
VKTVPNDATQTKENESKA                                                        841 - 858
//

Text Mined References (262)

PMID Year Title
26856773 2016 NK cell maturation to CD56(dim) subset associated with high levels of NCRs overrides the inhibitory effect of NKG2A and recovers impaired NK cell cytolytic potential after allogeneic hematopoietic stem cell transplantation.
26694817 2015 iCLIP identifies novel roles for SAFB1 in regulating RNA processing and neuronal function.
26597998 2016 Absence of both CD56 and CD117 expression on malignant plasma cells is related with a poor prognosis in patients with newly diagnosed multiple myeloma.
26503236 2015 Defining the value of CD56, CK19, Galectin 3 and HBME-1 in diagnosis of follicular cell derived lesions of thyroid with systematic review of literature.
26478212 2015 L1-CAM and N-CAM: From Adhesion Proteins to Pharmacological Targets.
26463893 2016 Coexistence of neuroblastoma and ganglioneuroma in a girl with a hemizygous deletion of chromosome 11q14.1-23.3.
26460482 2015 Brain structure, cognition and negative symptoms in schizophrenia are associated with serum levels of polysialic acid-modified NCAM.
26437631 2015 Identification of a FOXP3(+)CD3(+)CD56(+) population with immunosuppressive function in cancer tissues of human hepatocellular carcinoma.
26391771 2016 Neural cell adhesion molecule (CD56)-positive B cell lymphoma of the urinary bladder.
26344352 2015 Expression of CD56 in patients with adenomyosis and its correlation with dysmenorrhea.
26339384 2015 CD56 may be a more useful immunohistochemical marker than somatostatin receptor 2A for the diagnosis of phosphaturic mesenchymal tumors.
26255203 2015 MiR-30a-5p is induced by Wnt/?-catenin pathway and promotes glioma cell invasion by repressing NCAM.
26186733 2015 The Role of CD56 in Thyroid Fine Needle Aspiration Cytology: A Pilot Study Performed on Liquid Based Cytology.
26183877 2015 Prognostic factors of patients with newly diagnosed acute promyelocytic leukemia treated with arsenic trioxide-based frontline therapy.
26147745 2015 Prognostic impact of CD56 in pediatric AML.
26097548 2015 Role of cd56 and e-cadherin expression in the differential diagnosis of papillary thyroid carcinoma and suspected follicular-patterned lesions of the thyroid: the prognostic importance of e-cadherin.
26087825 2015 Interpreting CD56+ and CD163+ infiltrates in early versus late renal transplant biopsies.
26045862 2015 A case of a CD56-expressing ectomesenchymal chondromyxoid tumor of the tongue: potential diagnostic usefulness of commonly available CD56 over CD57.
26039898 2015 CD56+ T cells are increased in kidney transplant patients following cytomegalovirus infection.
26013700 Aberrant NK cell associated marker (CD56 and CD57) expression in chronic lymphocytic leukemia.
25935537 2015 CD56-negative extranodal NK/T cell lymphoma should be regarded as a distinct subtype with poor prognosis.
25924702 2015 Prognostic value of CD56 in patients with acute myeloid leukemia: a meta-analysis.
25921109 2015 The high expressed serum soluble neural cell adhesion molecule, a high risk factor indicating hepatic encephalopathy in hepatocelular carcinoma patients.
25889612 2015 NCAM (CD56) expression in keratin-producing odontogenic cysts: aberrant expression in KCOT.
25779340 2015 Human BDCA2+CD123+CD56+ dendritic cells (DCs) related to blastic plasmacytoid dendritic cell neoplasm represent a unique myeloid DC subset.
25769453 2015 Changed expression and function of P-gp in peripheral blood CD56 + cells predicting chemoresistance in non-Hodgkin lymphoma patients.
25723856 2015 t(14;16)-positive multiple myeloma shows negativity for CD56 expression and unfavorable outcome even in the era of novel drugs.
25628040 2015 Overexpression of miR-595 and miR-1246 in the sera of patients with active forms of inflammatory bowel disease.
25619885 2015 Symptomatic improvement, increased life-span and sustained cell homing in amyotrophic lateral sclerosis after transplantation of human umbilical cord blood cells genetically modified with adeno-viral vectors expressing a neuro-protective factor and a neural cell adhesion molecule.
25596273 2015 Multifunctional human CD56 low CD16 low natural killer cells are the prominent subset in bone marrow of both healthy pediatric donors and leukemic patients.
25445624 2014 Promoter variant rs2301228 on the neural cell adhesion molecule 1 gene confers risk of schizophrenia in Han Chinese.
25363560 2015 Effective induction of melanoma-antigen-specific CD8+ T cells via V?9??T cell expansion by CD56(high+) Interferon-?-induced dendritic cells.
25326085 2015 Ontogenic development of nerve fibers in human fetal livers: an immunohistochemical study using neural cell adhesion molecule (NCAM) and neuron-specific enolase (NSE).
25201755 2014 Direct involvement of CD56 in cytokine-induced killer-mediated lysis of CD56+ hematopoietic target cells.
25188863 2015 Primary cutaneous NK/T-cell lymphoma, nasal type and CD56-positive peripheral T-cell lymphoma: a cellular lineage and clinicopathologic study of 60 patients from Asia.
25137309 2014 Association of NCAM1 polymorphisms with autism and parental age at conception in a Chinese Han population.
24964207 2014 Genetic relationships between suicide attempts, suicidal ideation and major psychiatric disorders: a genome-wide association and polygenic scoring study.
24909369 2014 Increased frequency of ILT2-expressing CD56(dim)CD16(+) NK cells correlates with disease severity of pulmonary tuberculosis.
24807109 2014 Characterization of uterine NK cells in women with infertility or recurrent pregnancy loss and associated endometriosis.
24782118 2014 Correlation of CD11b and CD56 expression in adult acute myeloid leukemia with cytogenetic risk groups and prognosis.
24726913 2014 Cytoplasmic domain of NCAM140 interacts with ubiquitin-fold modifier-conjugating enzyme-1 (Ufc1).
24715165 2014 Diagnostic value of HBME-1, CD56, Galectin-3 and Cytokeratin-19 in papillary thyroid carcinomas and thyroid tumors of uncertain malignant potential.
24526449 2014 Nonuniform molecular features of myelinating Schwann cells in models for CMT1: distinct disease patterns are associated with NCAM and c-Jun upregulation.
24369228 2013 CD56 expression in normal immature granulocytes after allogeneic hematopoietic stem cell transplantation.
24365773 2014 Myocardial expression level of neural cell adhesion molecule correlates with reduced left ventricular function in human cardiomyopathy.
24349544 2013 Isolation and characterisation of a recombinant antibody fragment that binds NCAM1-expressing intervertebral disc cells.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24294395 2013 CD56 positive diffuse large B-cell lymphoma: a case report and literature review.
24286519 2013 CD56+ monocytes have a dysregulated cytokine response to lipopolysaccharide and accumulate in rheumatoid arthritis and immunosenescence.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24240977 2014 Immune status of Fanconi anemia patients: decrease in T CD8 and CD56dim CD16+ NK lymphocytes.
24206578 2014 Expression of CD56 is an unfavorable prognostic factor for acute promyelocytic leukemia with higher initial white blood cell counts.
24055371 2013 Reactivation of NCAM1 defines a subpopulation of human adult kidney epithelial cells with clonogenic and stem/progenitor properties.
23960070 2013 Dynein interacts with the neural cell adhesion molecule (NCAM180) to tether dynamic microtubules and maintain synaptic density in cortical neurons.
23810283 2013 CD56 expression is an independent prognostic factor for relapse in acute myeloid leukemia with t(8;21).
23716295 2013 NCAM polysialylation during adherence transitions: live cell monitoring using an antibody-mimetic EGFP-endosialidase and the viability dye DRAQ7.
23671285 2013 Polysialic acid is present in mammalian semen as a post-translational modification of the neural cell adhesion molecule NCAM and the polysialyltransferase ST8SiaII.
23635388 2013 Utility of the quantitative Ki-67 proliferation index and CD56 together in the cytologic diagnosis of small cell lung carcinoma and other lung neuroendocrine tumors.
23557873 CD3+CD56+natural killer T cells in fibromyalgia syndrome patients: association with the intensity of depression.
23495921 2013 Progression in multiple sclerosis is associated with low endogenous NCAM.
23480226 2013 New decision-tree model for defining the risk of reproductive failure.
23470050 2013 Immunohistochemical analysis of CD123, CD56 and CD4 for the diagnosis of minimal bone marrow involvement by blastic plasmacytoid dendritic cell neoplasm.
23462508 2013 The 140-kD isoform of CD56 (NCAM1) directs the molecular pathogenesis of ischemic cardiomyopathy.
23418554 2013 Simultaneous multi-antibody staining in non-small cell lung cancer strengthens diagnostic accuracy especially in small tissue samples.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23365458 2013 Mutations in GATA2 cause human NK cell deficiency with specific loss of the CD56(bright) subset.
23303482 2013 ANKK1, TTC12, and NCAM1 polymorphisms and heroin dependence: importance of considering drug exposure.
23292839 2013 Expression of NCAM (CD56), chromogranin A, synaptophysin, c-KIT (CD117) and PDGFRA in normal non-neoplastic skin and basal cell carcinoma: an immunohistochemical study of 66 consecutive cases.
23260340 2013 Amygdalar expression of proteins associated with neuroplasticity in major depression and suicide.
23258197 2013 Native soluble carcinoembryonic antigen is not involved in the impaired activity of CD56 natural killer cells in malignant pleural effusion.
23061666 2012 UCHL1 regulates ubiquitination and recycling of the neural cell adhesion molecule NCAM.
23022470 2012 Alterations in the expression of PSA-NCAM and synaptic proteins in the dorsolateral prefrontal cortex of psychiatric disorder patients.
23015367 2013 The influence of neural cell adhesion molecule isoform 140 on the metastasis of thyroid carcinoma.
22792160 2012 The CXCR3(+)CD56Bright phenotype characterizes a distinct NK cell subset with anti-fibrotic potential that shows dys-regulated activity in hepatitis C.
22732936 2012 Transforming growth factor-beta1 induces microvascular abnormalities through a down-modulation of neural cell adhesion molecule in human hepatocellular carcinoma.
22591692 2012 CD56+ T cells inhibit HIV-1 infection of macrophages.
22449227 2012 Differences of molecular expression mechanisms among neural cell adhesion molecule 1, synaptophysin, and chromogranin A in lung cancer cells.
22423624 2012 Patterns of expression of CD56 and CD117 on neoplastic plasma cells and association with genetically distinct subtypes of plasma cell myeloma.
22384181 2012 NCAM180 regulates Ric8A membrane localization and potentiates ?-adrenergic response.
22384114 2012 Cytotoxicity of CD56(bright) NK cells towards autologous activated CD4+ T cells is mediated through NKG2D, LFA-1 and TRAIL and dampened via CD94/NKG2A.
22319021 2012 Cytotoxic functions and susceptibility to apoptosis of human CD56(bright) NK cells differentiated in vitro from CD34? hematopoietic progenitors.
22281821 2012 Expression and localization of neural cell adhesion molecule and polysialic acid during chick corneal development.
22276608 2012 Flow cytometric detection and quantification of CD56 (neural cell adhesion molecule, NCAM) expression in diffuse large B cell lymphomas and review of the literature.
22228741 2012 Dehydroepiandrosterone (DHEA) inhibition of monocyte binding by vascular endothelium is associated with sialylation of neural cell adhesion molecule.
22219127 2012 Role of a neural cell adhesion molecule found in cerebrospinal fluid as a potential biomarker for epilepsy.
22211388 2012 Prominent CD56 expression by damaged and regenerating muscle fibers in the skin.
22099865 2012 Expression of PSA-NCAM and synaptic proteins in the amygdala of psychiatric disorder patients.
22085395 2012 Serum neural cell adhesion molecule is hyposialylated in hereditary inclusion body myopathy.
22081445 2012 Prognostic significance of CD56 antigen expression in patients with acute myeloid leukemia.
22001684 2011 Circulating CD8+CD56-perforin+ T cells are increased in multiple sclerosis patients.
21940794 2011 Polysialic acid controls NCAM signals at cell-cell contacts to regulate focal adhesion independent from FGF receptor activity.
21739604 2011 The adhesion molecule NCAM promotes ovarian cancer progression via FGFR signalling.
21717310 2011 CD56 expression is associated with neuroectodermal differentiation in ameloblastomas: an immunohistochemical evaluation in comparison with odontogenic cystic lesions.
21691800 2012 Selective interaction of amyloid precursor protein with different isoforms of neural cell adhesion molecule.
21669487 2011 Hepatocellular carcinoma with progenitor cell features distinguishable by the hepatic stem/progenitor cell marker NCAM.
21666061 2011 Unexpected role for granzyme K in CD56bright NK cell-mediated immunoregulation of multiple sclerosis.
21577011 2011 NCAM1, TACR1 and NOS genes and temperament: a study on suicide attempters and controls.
21515372 2011 Transgenic mice overexpressing the extracellular domain of NCAM are impaired in working memory and cortical plasticity.
21467162 2011 Excellent prognosis in a subset of patients with Ewing sarcoma identified at diagnosis by CD56 using flow cytometry.
21464126 2011 Structural and functional impairments of polysialic acid by a mutated polysialyltransferase found in schizophrenia.
21457956 2011 Maturation of human ovarian follicles is accompanied by a decrease in the CD56+CD16+ natural killer cell population.
21239711 2011 Involvement of CD56brightCD11c+ cells in IL-18-mediated expansion of human ?? T cells.
21212386 2011 Genetic variation in NCAM1 contributes to left ventricular wall thickness in hypertensive families.
21178331 2011 The CD6 scavenger receptor is differentially expressed on a CD56 natural killer cell subpopulation and contributes to natural killer-derived cytokine and chemokine secretion.
21148082 2011 Clinical significance of CD56 expression in patients with acute promyelocytic leukemia treated with all-trans retinoic acid and anthracycline-based regimens.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
21115007 2011 Direct demonstration of NCAM cis-dimerization and inhibitory effect of palmitoylation using the BRET2 technique.
20932956 2010 Brain-derived neurotrophic factor (BDNF) and polysialylated-neural cell adhesion molecule (PSA-NCAM): codistribution in the human brainstem precerebellar nuclei from prenatal to adult age.
20875069 2010 CD56 (NCAM) expression in ameloblastomas and other odontogenic lesions.
20805222 2010 Sequences from the first fibronectin type III repeat of the neural cell adhesion molecule allow O-glycan polysialylation of an adhesion molecule chimera.
20733159 2010 CD57 defines a functionally distinct population of mature NK cells in the human CD56dimCD16+ NK-cell subset.
20696944 2010 Expression patterns of NKG2A, KIR, and CD57 define a process of CD56dim NK-cell differentiation uncoupled from NK-cell education.
20684989 2011 Prognostic factors in normal karyotype acute myeloid leukemia in the absence of the FLT3-ITD mutation.
20664990 2010 Natural killer-like T CD3+/CD16+CD56+ cells in chronic lymphocytic leukemia: intracellular cytokine expression and relationship with clinical outcome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20610389 2010 Functional consequences of the interactions among the neural cell adhesion molecule NCAM, the receptor tyrosine kinase TrkB, and the inwardly rectifying K+ channel KIR3.3.
20557674 2010 CD56-positive diffuse large B-cell lymphoma: possible association with extranodal involvement and bcl-6 expression.
20538416 2010 Biliary cytokeratin expression but not CD56 (N-CAM) expression aids in the differential diagnosis of non-neoplastic bile duct diseases.
20524836 Immunohistochemical expression of neural cell adhesion molecule in Wilms tumors, nephrogenic rests, and fetal and postnatal renal cortices.
20483466 2010 Influence of neuronal cell adhesion molecule (NCAM1) variants on suicidal behaviour and correlated traits.
20414008 2010 Effect of human colorectal carcinogenesis on the neural cell adhesion molecule expression and polysialylation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20231901 2010 Upregulation of SOCS-3 and PIAS-3 impairs IL-12-mediated interferon-gamma response in CD56 T cells in HCV-infected heroin users.
20187302 2009 Developmental tumourigenesis: NCAM as a putative marker for the malignant renal stem/progenitor cell population.
20164549 2010 Altered NCAM expression associated with the cholinergic system in Alzheimer's disease.
20083228 2010 Genome-wide analysis of chromosomal alterations in patients with esophageal squamous cell carcinoma exposed to tobacco and betel quid from high-risk area in India.
20059553 2010 The role of NCAM in auditory fear conditioning and its modulation by stress: a focus on the amygdala.
20049565 2010 CD56 expression in human myeloma cells derived from the neurogenic gene expression: possible role of the SRY-HMG box gene, SOX4.
20029409 2010 Association of polymorphisms in the SLIT2 axonal guidance gene with anger in suicide attempters.
20027291 2009 Salmonella induced IL-23 and IL-1beta allow for IL-12 production by monocytes and Mphi1 through induction of IFN-gamma in CD56 NK/NK-like T cells.
20015889 2010 Mouse mesenchymal stem cells can support human hematopoiesis both in vitro and in vivo: the crucial role of neural cell adhesion molecule.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19897577 2010 CD94 surface density identifies a functional intermediary between the CD56bright and CD56dim human NK-cell subsets.
19864234 2009 Utility of CD56 immunohistochemical studies in follow-up of plasma cell myeloma.
19788615 2009 Mucosal remodeling in long-standing ulcerative colitis with colorectal neoplasia: significant alterations of NCAM+ or alpha-SMA+ subepithelial myofibroblasts and interstitial cells.
19788570 2009 NCAM expression induces neurogenesis in vivo.
19772585 2009 Control of CD56 expression and tumor cell cytotoxicity in human Vgamma2Vdelta2 T cells.
19725832 2010 N-CAM dysfunction and unexpected accumulation of PSA-NCAM in brain of adult-onset autosomal-dominant leukodystrophy.
19724850 2009 Aberrant expression of class III beta-tubulin in basal cell carcinoma of the skin.
19652998 2009 Clinical relevance of neuroendocrine differentiation in non-small cell lung cancer assessed by immunohistochemistry: a retrospective study on 405 surgically resected cases.
19587433 2009 [Mutation analysis of neural cell adhesion molecules in human astrocytoma].
19507465 Neural cell adhesion molecule expression in the human carotid body.
19411161 2009 Regional and duration of illness differences in the alteration of NCAM-180 mRNA expression within the cortex of subjects with schizophrenia.
19393299 2009 Developmental regulation of neural cell adhesion molecule in human prefrontal cortex.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
19328310 2009 [Two cases of subcutaneous panniculitis-like T-cell lymphoma (CD4- CD8+ CD56-)].
19235015 2009 Regulation of the CD56 promoter and its association with proliferation, anti-apoptosis and clinical factors in multiple myeloma.
19222860 2009 Absence of polysialylated NCAM is an unfavorable prognostic phenotype for advanced stage neuroblastoma.
19153015 2009 Diagnostic utility of CD56 immunohistochemistry in papillary carcinoma of the thyroid.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18990213 2008 Polysialylated-neural cell adhesion molecule (PSA-NCAM) in the human trigeminal ganglion and brainstem at prenatal and adult ages.
18979395 2008 Placental expression of insulin-like growth factor-I, fibroblast growth factor-basic, and neural cell adhesion molecule in preeclampsia.
18972120 2008 Universal expression of cell adhesion molecule NCAM in neuroblastoma in contrast to L1: implications for different roles in tumor biology of neuroblastoma?
18828801 2008 Haplotypic variants in DRD2, ANKK1, TTC12, and NCAM1 are associated with comorbid alcohol and drug dependence.
18755075 2008 NCAM as a cystogenesis marker gene of PKD2 overexpression.
18641363 2008 An unusual CD56(bright) CD16(low) NK cell subset dominates the early posttransplant period following HLA-matched hematopoietic stem cell transplantation.
18628406 2008 CD56bright cells increase expression of {alpha}4 integrin at ovulation in fertile cycles.
18601968 2008 No genetic association between NCAM1 gene polymorphisms and schizophrenia in the Chinese population.
18594005 2008 Isopentenyl pyrophosphate-activated CD56+ {gamma}{delta} T lymphocytes display potent antitumor activity toward human squamous cell carcinoma.
18462256 2008 Clinicopathological features of extramedullary recurrence/relapse of multiple myeloma.
18432248 2008 Placental expression of insulin-like growth factor-I, fibroblast growth factor-basic and neural cell adhesion molecule in pregnancies with small for gestational age fetuses.
18425046 2008 Expression of CD56 and WT1 in ovarian stroma and ovarian stromal tumors.
18384787 2008 Polysialylated NCAM represses E-cadherin-mediated cell-cell adhesion in pancreatic tumor cells.
18368482 2008 A peptide motif from the second fibronectin module of the neural cell adhesion molecule, NCAM, NLIKQDDGGSPIRHY, is a binding site for the FGF receptor.
18353777 2008 Insights into GFRalpha1 regulation of neural cell adhesion molecule (NCAM) function from structure-function analysis of the NCAM/GFRalpha1 receptor complex.
18333845 2008 Aberrant co-expression of CD19 and CD56 as surrogate markers of acute myeloid leukemias with t(8;21) in Taiwan.
18323797 2008 Association between high expression of natural killer related-genes (NCAM/CD94) and early death during induction in children with acute myeloid leukemia.
18289872 2008 Developmental regulation of GABAergic interneuron branching and synaptic development in the prefrontal cortex by soluble neural cell adhesion molecule.
18261743 2008 Structure of the tandem fibronectin type 3 domains of neural cell adhesion molecule.
18231917 2008 Clinicopathological correlates of plasma cell CD56 (NCAM) expression in multiple myeloma.
18213713 2008 Neural cell adhesion molecule (NCAM) isoform expression is associated with neuroblastoma differentiation status.
18209097 2008 Induction of CD56 and TCR-independent activation of T cells with aging.
17982624 2007 Expression of neural cell adhesion molecule in salivary adenoid cystic carcinoma and its correlation with perineural invasion.
17971410 2007 NCAM is ubiquitylated, endocytosed and recycled in neurons.
17940597 2007 Phenotypic studies of natural killer cell subsets in human transporter associated with antigen processing deficiency.
17900814 2007 Down-regulation of the axonal polysialic acid-neural cell adhesion molecule expression coincides with the onset of myelination in the human fetal forebrain.
17891186 2007 Lack of CD56 expression on myeloma cells is not a marker for poor prognosis in patients treated by high-dose chemotherapy and is associated with translocation t(11;14).
17878347 2007 The CD16- CD56(bright) NK cell subset is resistant to reactive oxygen species produced by activated granulocytes and has higher antioxidative capacity than the CD16+ CD56(dim) subset.
17761687 2007 Association of haplotypic variants in DRD2, ANKK1, TTC12 and NCAM1 to alcohol dependence in independent case control and family samples.
17683591 2007 Impact of polysialylated CD56 on natural killer cell cytotoxicity.
17635242 2007 Neural cell adhesion molecule (CD56)-positive B-cell lymphoma.
17467233 2007 PSA-NCAM expression in the human prefrontal cortex.
17431094 2007 HIV-1 Nef impairs the dynamic of DC/NK crosstalk: different outcome of CD56(dim) and CD56(bright) NK cell subsets.
17413444 2007 NCAM1 association study of bipolar disorder and schizophrenia: polymorphisms and alternatively spliced isoforms lead to similarities and differences.
17337466 2007 Neural cell adhesion molecule expression on renal interstitial cells.
17216340 2007 Alteration of serum and tumoral neural cell adhesion molecule (NCAM) isoforms in patients with brain tumors.
17213291 2007 FcRL6, a new ITIM-bearing receptor on cytolytic cells, is broadly expressed by lymphocytes following HIV-1 infection.
17208489 2007 Role of GPI-anchored NCAM-120 in rabies virus infection.
17181871 2006 Chemoresistance induces enhanced adhesion and transendothelial penetration of neuroblastoma cells by down-regulating NCAM surface expression.
17161382 2007 NCAM1 and neurocognition in schizophrenia.
17085484 2006 Haplotype spanning TTC12 and ANKK1, flanked by the DRD2 and NCAM1 loci, is strongly associated to nicotine dependence in two distinct American populations.
17043020 2006 Concomitant aberrant overexpression of RUNX1 and NCAM in regenerating bone marrow of myeloid leukemia of Down's syndrome.
17005551 2006 The fibroblast growth factor receptor acid box is essential for interactions with N-cadherin and all of the major isoforms of neural cell adhesion molecule.
17003032 2006 A novel alpha-helix in the first fibronectin type III repeat of the neural cell adhesion molecule is critical for N-glycan polysialylation.
16892559 2004 [The overexpression of NCAM (CD56) in human hearts is specific for ischemic damage].
16690409 2005 NKG2A and CD56 are coexpressed on activated TH2 but not TH1 lymphocytes.
16627685 2006 The phenotypes of pluripotent human hepatic progenitors.
16572491 Identical twins discordant for type 1 diabetes show a different pattern of in vitro CD56+ cell activation.
16534119 2006 NCAM is hyposialylated in hereditary inclusion body myopathy due to GNE mutations.
16406048 2006 Neural-cell adhesion molecule (NCAM) expression by immature and tumor-derived endothelial cells favors cell organization into capillary-like structures.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16316416 2005 Human CD56bright and CD56dim natural killer cell subsets respond differentially to direct stimulation with Mycobacterium bovis bacillus Calmette-Guérin.
16211277 2005 Induction of apoptosis in human salivary gland tumor cells by anti-NCAM antibody.
16172115 2005 Degree of polymerization (DP) of polysialic acid (polySia) on neural cell adhesion molecules (N-CAMS): development and application of a new strategy to accurately determine the DP of polySia chains on N-CAMS.
16027151 2005 Specific amino acids in the first fibronectin type III repeat of the neural cell adhesion molecule play a role in its recognition and polysialylation by the polysialyltransferase ST8Sia IV/PST.
15950781 2005 Neuroprotection mediated by subtoxic dose of NMDA in SH-SY5Y neuroblastoma cultures: activity-dependent regulation of PSA-NCAM expression.
15822905 Phosphoproteomic analysis of synaptosomes from human cerebral cortex.
15782066 2005 CD56 reactivity in small cell carcinoma of the uterine cervix.
15626024 Acute lymphoblastic leukemia with coexpression of CD56 and CD57: case report.
15528382 2004 CD56bright NK cells are enriched at inflammatory sites and can engage with monocytes in a reciprocal program of activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459479 2004 Expression patterns of PSA-NCAM in the human ganglionic eminence and its vicinity: role of PSA-NCAM in neuronal migration and axonal growth?
15356097 2004 A novel epitope of N-CAM defines precursors of human adherent NK cells.
15246157 2004 A Wilms tumor cell line, HFWT, can greatly stimulate proliferation of CD56+ human natural killer cells and their novel precursors in blood mononuclear cells.
15231874 2004 Pituitary tumor-derived fibroblast growth factor receptor 4 isoform disrupts neural cell-adhesion molecule/N-cadherin signaling to diminish cell adhesiveness: a mechanism underlying pituitary neoplasia.
15223636 2004 Clinical and biological significance of CD56 antigen expression in acute promyelocytic leukemia.
15146195 2004 Time-controlled transcardiac perfusion cross-linking for the study of protein interactions in complex tissues.
15061198 2004 Prognostic significance of surface markers expressed in multiple myeloma: CD56 and other antigens.
15050861 2004 Association of neural cell adhesion molecule 1 gene polymorphisms with bipolar affective disorder in Japanese individuals.
15006709 2004 Neural cell adhesion molecule in human serum. Increased levels in dementia of the Alzheimer type.
14959847 2003 The expression pattern of CD56 (N-CAM) in human bone marrow biopsies infiltrated by acute leukemia.
14726964 2003 CD56-positive cells with or without synaptophysin expression are recognized in the pancreatic duct epithelium: a study with adult and fetal tissues and specimens from chronic pancreatitis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14688313 2004 The IL-12 signature: NK cell terminal CD56+high stage and effector functions.
12937148 2003 NCAM(CD56) and RUNX1(AML1) are up-regulated in human ischemic cardiomyopathy and a rat model of chronic cardiac ischemia.
12837245 2003 The neural cell adhesion molecule NCAM is an alternative signaling receptor for GDNF family ligands.
12791681 2003 The minimal structural domains required for neural cell adhesion molecule polysialylation by PST/ST8Sia IV and STX/ST8Sia II.
12743109 2003 Neural cell adhesion molecule (NCAM) association with PKCbeta2 via betaI spectrin is implicated in NCAM-mediated neurite outgrowth.
12727026 2003 CD56: a useful marker for diagnosing Merkel cell carcinoma.
12594840 2003 Preferential apoptosis of CD56dim natural killer cell subset in patients with cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12121226 2002 Costimulation of T cell receptor-triggered IL-2 production by Jurkat T cells via fibroblast growth factor receptor 1 upon its engagement by CD56.
11839780 2002 NCAM regulates cell motility.
11685193 2001 Alternative mRNA splicing in colon cancer causes loss of expression of neural cell adhesion molecule.
11681838 2001 Characterization of human cleaved N-CAM and association with schizophrenia.
10770948 2000 Overexpression of murine Pax3 increases NCAM polysialylation in a human medulloblastoma cell line.
10766765 2000 Differential biosynthesis of polysialic acid on neural cell adhesion molecule (NCAM) and oligosaccharide acceptors by three distinct alpha 2,8-sialyltransferases, ST8Sia IV (PST), ST8Sia II (STX), and ST8Sia III.
10760298 2000 Brain-derived neurotrophic factor restores long-term potentiation in polysialic acid-neural cell adhesion molecule-deficient hippocampus.
10611478 1999 Homophilic NCAM interactions interfere with L1 stimulated neurite outgrowth.
9951628 The neural cell adhesion molecule (NCAM) in development and plasticity of the nervous system.
9774483 1998 Differential and cooperative polysialylation of the neural cell adhesion molecule by two polysialyltransferases, PST and STX.
9696812 1998 The neural cell adhesion molecule is a receptor for rabies virus.
9079653 1997 NCAM140 interacts with the focal adhesion kinase p125(fak) and the SRC-related tyrosine kinase p59(fyn).
8910306 1996 Analysis of neurocan structures interacting with the neural cell adhesion molecule N-CAM.
8702635 1996 Characterization of mouse ST8Sia II (STX) as a neural cell adhesion molecule-specific polysialic acid synthase. Requirement of core alpha1,6-linked fucose and a polypeptide chain for polysialylation.
8509458 1993 The fourth immunoglobulin-like domain of NCAM contains a carbohydrate recognition domain for oligomannosidic glycans implicated in association with L1 and neurite outgrowth.
8493579 1993 Human Sos1: a guanine nucleotide exchange factor for Ras that binds to GRB2.
8075973 1994 Complementary DNA sequence encoding the major neural cell adhesion molecule isoform in a human small cell lung cancer cell line.
7854457 1995 Molecular characterization of eukaryotic polysialyltransferase-1.
7755976 1995 Localization of NCAM on NCAM-B-expressing cells with inhibited migration in collagen.
7624364 1995 Expression cloning of a human polysialyltransferase that forms the polysialylated neural cell adhesion molecule present in embryonic brain.
3576199 1987 Neural cell adhesion molecule: structure, immunoglobulin-like domains, cell surface modulation, and alternative RNA splicing.
3281256 1988 The neural cell adhesion molecule (NCAM) as a regulator of cell-cell interactions.
3253057 1988 Complete sequence and in vitro expression of a tissue-specific phosphatidylinositol-linked N-CAM isoform from skeletal muscle.
3203385 1988 Alternative splicing generates a secreted form of N-CAM in muscle and brain.
2887295 1987 Human muscle neural cell adhesion molecule (N-CAM): identification of a muscle-specific sequence in the extracellular domain.
2612216 1989 Precise in situ localization of NCAM, ETS1, and D11S29 on human meiotic chromosomes.
1710251 1991 Molecular and functional analysis of human natural killer cell-associated neural cell adhesion molecule (N-CAM/CD56).
1543753 1992 A discordance between the human muscle NCAM sequence and those seen in other NCAM cDNA clones.
1339414 1992 Splicing of the VASE exon of neural cell adhesion molecule (NCAM) in human small-cell lung carcinoma (SCLC).