Property Summary

NCBI Gene PubMed Count 30
PubMed Score 20.21
PubTator Score 13.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -1.200 1.8e-02
psoriasis -1.800 6.6e-08
glioblastoma -2.300 6.4e-03
oligodendroglioma -1.200 5.7e-10
group 4 medulloblastoma -2.500 1.4e-03
atypical teratoid / rhabdoid tumor -2.700 9.1e-05
medulloblastoma, large-cell -3.500 1.5e-03
primitive neuroectodermal tumor -1.700 4.0e-02
tuberculosis 1.400 1.1e-05
non-small cell lung cancer -1.207 6.3e-13
intraductal papillary-mucinous adenoma (... -1.100 7.0e-03
active Crohn's disease 1.092 3.4e-02
ulcerative colitis 1.200 6.8e-04
lung adenocarcinoma -1.500 1.1e-17
pediatric high grade glioma -1.700 1.2e-02
invasive ductal carcinoma -1.300 2.1e-02
Breast cancer -3.200 7.6e-20
lung carcinoma 1.700 7.6e-17
breast carcinoma -1.400 2.9e-18
Pick disease -1.800 2.1e-02
ovarian cancer 1.400 8.2e-04
Down syndrome -1.500 1.3e-02

Gene RIF (6)

PMID Text
23156397 It is presumed that NCALD is related to diabetic nephropathy by promoting epithelial mesenchymal transform.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18500817 Studies show that a fold recognition based model of the catalytic domain of ROS-GC1 was built, and neurocalcin delta docking simulations were carried out to define the three-dimensional features of the interacting domains of the two molecules.
17671797 association of the landmark SNP with the progression of diabetic nephropathy in a 8-year prospective study
17671797 Observational study of gene-disease association. (HuGE Navigator)
7852401 The author characterizes the biochemical properties of recombinant bovine neurocalcin delta, whose protein sequence is identical to the human ortholog

AA Sequence

MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFR      1 - 70
TFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPE     71 - 140
DESTPEKRTEKIFRQMDTNRDGKLSLEEFIRGAKSDPSIVRLLQCDPSSAGQF                     141 - 193
//

Text Mined References (30)

PMID Year Title
25519916 2014 The EHEC-host interactome reveals novel targets for the translocated intimin receptor.
25416956 2014 A proteome-scale map of the human interactome network.
24939585 2015 Genome-wide association analysis demonstrates the highly polygenic character of age-related hearing impairment.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23156397 2012 [Genetic study for diabetic microvascular complications--recent advances and future perspectives].
21876539 2012 Genome-wide association analysis of coffee drinking suggests association with CYP1A1/CYP1A2 and NRCAM.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
19342380 2009 Glutamate binding and conformational flexibility of ligand-binding domains are critical early determinants of efficient kainate receptor biogenesis.
18500817 2008 Neurocalcin delta modulation of ROS-GC1, a new model of Ca(2+) signaling.
17671797 2007 Polymorphisms in the 3' UTR in the neurocalcin delta gene affect mRNA stability, and confer susceptibility to diabetic nephropathy.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11964161 2002 Identification of Ca2+-dependent binding partners for the neuronal calcium sensor protein neurocalcin delta: interaction with actin, clathrin and tubulin.
11836243 2002 Differential use of myristoyl groups on neuronal calcium sensor proteins as a determinant of spatio-temporal aspects of Ca2+ signal transduction.
11267673 2001 Molecular cloning, mapping and characterization of the human neurocalcin delta gene (NCALD).
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11115393 2001 The neuronal calcium sensor family of Ca2+-binding proteins.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
7852401 1995 Calcium and membrane binding properties of bovine neurocalcin delta expressed in Escherichia coli.