Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.63
PubTator Score 6.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
lung adenocarcinoma 1.200 1.2e-09
lung carcinoma 2.000 3.1e-23
Breast cancer 1.200 1.5e-14
invasive ductal carcinoma 1.300 8.0e-05
ovarian cancer 1.800 4.2e-05

Gene RIF (7)

PMID Text
26114227 AIBp contributes to mitotic entry and bipolar spindle assembly.
23719382 AIBP accelerates cholesterol efflux from endothelial cells to HDL and thereby regulates angiogenesis
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20855565 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
17521614 Taken together, the current study demonstrates that APN might protect against atherosclerosis by increasing HDL assembly through enhancing ABCA1 pathway and apoA-1 synthesis in the liver.

AA Sequence

MSRLRALLGLGLLVAGSRVPRIKSQTIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYLSQEEAQAVDQ      1 - 70
ELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTI     71 - 140
YYPKRPNKPLFTALVTQCQKMDIPFLGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGL    141 - 210
TVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPD    211 - 280
TECVYRLQ                                                                  281 - 288
//

Text Mined References (20)

PMID Year Title
26114227 2015 AIBp regulates mitotic entry and mitotic spindle assembly by controlling activation of both Aurora-A and Plk1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23719382 2013 Control of angiogenesis by AIBP-mediated cholesterol efflux.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
21994945 2011 Extremely conserved ATP- or ADP-dependent enzymatic system for nicotinamide nucleotide repair.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
17533573 2007 ApoA-I-binding protein (AI-BP) and its homologues hYjeF_N2 and hYjeF_N3 comprise the YjeF_N domain protein family in humans with a role in spermiogenesis and oogenesis.
17521614 2007 Adiponectin accelerates reverse cholesterol transport by increasing high density lipoprotein assembly in the liver.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11991719 2002 Cloning and characterization of a novel apolipoprotein A-I binding protein, AI-BP, secreted by cells of the kidney proximal tubules in response to HDL or ApoA-I.