Property Summary

NCBI Gene PubMed Count 22
PubMed Score 22.79
PubTator Score 20.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
urothelial carcinoma -1.100 2.0e-03
ependymoma -2.000 4.8e-10
oligodendroglioma -1.800 1.3e-14
astrocytoma -1.700 6.3e-03
glioblastoma -3.000 1.6e-02
group 4 medulloblastoma -3.300 4.5e-07
atypical teratoid / rhabdoid tumor -2.300 7.9e-04
medulloblastoma, large-cell -3.700 4.6e-06
Atopic dermatitis -1.300 3.2e-04
adrenocortical carcinoma -2.259 5.4e-05
intraductal papillary-mucinous adenoma (... -1.600 7.5e-03
intraductal papillary-mucinous carcinoma... -1.700 6.8e-03
breast carcinoma -1.400 1.5e-06
interstitial cystitis -1.300 1.8e-02
pediatric high grade glioma -2.200 4.0e-06
pilocytic astrocytoma -1.800 2.2e-07
aldosterone-producing adenoma -1.765 1.6e-03
subependymal giant cell astrocytoma -1.745 1.9e-02
psoriasis 1.200 1.3e-06
Alzheimer's disease -1.200 3.0e-02
Pick disease -1.700 1.2e-03
Breast cancer -1.600 8.8e-08
invasive ductal carcinoma -2.100 7.1e-04
ovarian cancer -2.900 8.8e-15

Gene RIF (11)

PMID Text
26210448 Together, our findings suggest an important role for miR-21 in the progression of HCC, which negatively regulated Navigator-3 in the migration of HCC.
25678558 The authers propose that NAV3 inhibits breast cancer progression by regulating microtubule dynamics, biasing directionally persistent rather than random migration, and inhibiting locomotion of initiated cells.
23097141 Data indicate that neuron navigator 3 (NAV3) may be a potential new prognostic biomarker and a potential therapeutic target.
22173670 NAV3 has a role in linking tissue inflammation to cancer development in the colon.
21995814 characterized copy number changes of NAV3 in 24 basal cell cancers, eight squamous cell cancers and eight non-malignant inflammatory skin lesions
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19626031 NAV3 gene would not be frequently deleted in cutaneous type leukemia/lymphoma including those with mycosis fungoides-like manifestations
18509363 An imbalanced fluorescence in situ hybridization pattern between NAV3 and pericentromeric control probes was seen in three patients in accordance with CGH array data. No NAV3 specific breakpoint or partial deletion was detected.
18337827 Allelic NAV3 aberrations (LOH or deletion by FISH were identified in 44% of the subcutaneous panniculitis-like T-cell lymphoma samples.

AA Sequence

MPVLGVASKLRQPAVGSKPVHTALPIPNLGTTGSQHCSSRPLELTETESSMLSCQLALKSTCEFGEKKPL      1 - 70
QGKAKEKEDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLAEIIQIIANEKVEDINGCPRSQSQMIE     71 - 140
NVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLSRYKQQQHHQQQYYQSLVELQQRVTHASPPS    141 - 210
EASQAKTQQDMQSSLAARYATQSNHSGIATSQKKPTRLPGPSRVPAAGSSSKVQGASNLNRRSQSFNSID    211 - 280
KNKPPNYANGNEKDSSKGPQSSSGVNGNVQPPSTAGQPPASAIPSPSASKPWRSKSMNVKHSATSTMLTV    281 - 350
KQSSTATSPTPSSDRLKPPVSEGVKTAPSGQKSMLEKFKLVNARTALRPPQPPSSGPSDGGKDDDAFSES    351 - 420
GEMEGFNSGLNSGGSTNSSPKVSPKLAPPKAGSKNLSNKKSLLQPKEKEEKNRDKNKVCTEKPVKEEKDQ    421 - 490
VTEMAPKKTSKIASLIPKGSKTTAAKKESLIPSSSGIPKPGSKVPTVKQTISPGSTASKESEKFRTTKGS    491 - 560
PSQSLSKPITMEKASASSCPAPLEGREAGQASPSGSCTMTVAQSSGQSTGNGAVQLPQQQQHSHPNTATV    561 - 630
APFIYRAHSENEGTALPSADSCTSPTKMDLSYSKTAKQCLEEISGEDPETRRMRTVKNIADLRQNLEETM    631 - 700
SSLRGTQISHSTLETTFDSTVTTEVNGRTIPNLTSRPTPMTWRLGQACPRLQAGDAPSLGAGYPRSGTSR    701 - 770
FIHTDPSRFMYTTPLRRAAVSRLGNMSQIDMSEKASSDLDMSSEVDVGGYMSDGDILGKSLRTDDINSGY    771 - 840
MTDGGLNLYTRSLNRIPDTATSRDIIQRGVHDVTVDADSWDDSSSVSSGLSDTLDNISTDDLNTTSSVSS    841 - 910
YSNITVPSRKNTQLRTDSEKRSTTDETWDSPEELKKPEEDFDSHGDAGGKWKTVSSGLPEDPEKAGQKAS    911 - 980
LSVSQTGSWRRGMSAQGGAPSRQKAGTSALKTPGKTDDAKASEKGKAPLKGSSLQRSPSDAGKSSGDEGK    981 - 1050
KPPSGIGRSTATSSFGFKKPSGVGSSAMITSSGATITSGSATLGKIPKSAAIGGKSNAGRKTSLDGSQNQ   1051 - 1120
DDVVLHVSSKTTLQYRSLPRPSKSSTSGIPGRGGHRSSTSSIDSNVSSKSAGATTSKLREPTKIGSGRSS   1121 - 1190
PVTVNQTDKEKEKVAVSDSESVSLSGSPKSSPTSASACGAQGLRQPGSKYPDIASPTFRRLFGAKAGGKS   1191 - 1260
ASAPNTEGVKSSSVMPSPSTTLARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSDLTTDVISLSHSLA   1261 - 1330
SSPASVHSFTSGGLVWAANMSSSSAGSKDTPSYQSMTSLHTSSESIDLPLSHHGSLSGLTTGTHEVQSLL   1331 - 1400
MRTGSVRSTLSESMQLDRNTLPKKGLRYTPSSRQANQEEGKEWLRSHSTGGLQDTGNQSPLVSPSAMSSS   1401 - 1470
AAGKYHFSNLVSPTNLSQFNLPGPSMMRSNSIPAQDSSFDLYDDSQLCGSATSLEERPRAISHSGSFRDS   1471 - 1540
MEEVHGSSLSLVSSTSSLYSTAEEKAHSEQIHKLRRELVASQEKVATLTSQLSANAHLVAAFEKSLGNMT   1541 - 1610
GRLQSLTMTAEQKESELIELRETIEMLKAQNSAAQAAIQGALNGPDHPPKDLRIRRQHSSESVSSINSAT   1611 - 1680
SHSSIGSGNDADSKKKKKKNWVNSRGSELRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNA   1681 - 1750
GDCGSASMKPSQSASASPLVWPPKKRQNGPVIYKHRSRICECTEAEAEIILQLKSELREKELKLTDIRLE   1751 - 1820
ALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTAKPTRPPSESSSSTSSSSSRQSLGLSLNNLN   1821 - 1890
ITEAVSSDILLDDAGDATGHKDGRSVKIIVSISKGYGRAKDQKSQAYLIGSIGVSGKTKWDVLDGVIRRL   1891 - 1960
FKEYVFRIDTSTSLGLSSDCIASYCIGDLIRSHNLEVPELLPCGYLVGDNNIITVNLKGVEENSLDSFVF   1961 - 2030
DTLIPKPITQRYFNLLMEHHRIILSGPSGTGKTYLANKLAEYVITKSGRKKTEDAIATFNVDHKSSKELQ   2031 - 2100
QYLANLAEQCSADNNGVELPVVIILDNLHHVGSLSDIFNGFLNCKYNKCPYIIGTMNQGVSSSPNLELHH   2101 - 2170
NFRWVLCANHTEPVKGFLGRYLRRKLIEIEIERNIRNNDLVKIIDWIPKTWHHLNSFLETHSSSDVTIGP   2171 - 2240
RLFLPCPMDVEGSRVWFMDLWNYSLVPYILEAVREGLQMYGKRTPWEDPSKWVLDTYPWSSATLPQESPA   2241 - 2310
LLQLRPEDVGYESCTSTKEATTSKHIPQTDTEGDPLMNMLMKLQEAANYSSTQSCDSESTSHHEDILDSS   2311 - 2380
LESTL                                                                    2381 - 2385
//

Text Mined References (25)

PMID Year Title
26210448 2015 MiR-21 promoted proliferation and migration in hepatocellular carcinoma through negative regulation of Navigator-3.
25678558 2015 Navigator-3, a modulator of cell migration, may act as a suppressor of breast cancer progression.
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
23097141 2013 Neuron navigator 3 alterations in nervous system tumors associate with tumor malignancy grade and prognosis.
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
22173670 2012 Potential role of a navigator gene NAV3 in colorectal cancer.
21995814 2011 NAV3 copy number changes and target genes in basal and squamous cell cancers.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20707712 2010 A genome-wide association study of self-rated health.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19626031 2010 Cutaneous-type adult T-cell leukemia/lymphoma does not primarily show deletion of NAV3 gene.
19247474 2009 Genome-wide and candidate gene association study of cigarette smoking behaviors.
18509363 2008 Primary cutaneous T-cell lymphomas do not show specific NAV3 gene deletion or translocation.
18337827 2008 Clinicopathological characterization and genomic aberrations in subcutaneous panniculitis-like T-cell lymphoma.
16541075 2006 The finished DNA sequence of human chromosome 12.
16166283 2005 Primary cutaneous T-cell lymphomas show a deletion or translocation affecting NAV3, the human UNC-53 homologue.
15158073 2004 Sensory deficits in mice hypomorphic for a mammalian homologue of unc-53.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12079279 2002 Neuron navigator: a human gene family with homology to unc-53, a cell guidance gene from Caenorhabditis elegans.
12062803 2002 Pore membrane and/or filament interacting like protein 1 (POMFIL1) is predominantly expressed in the nervous system and encodes different protein isoforms.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.