Property Summary

NCBI Gene PubMed Count 23
PubMed Score 35.62
PubTator Score 14.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Hepatitis 61
Disease Target Count P-value
breast carcinoma 1614 8.6e-20
Breast cancer 3098 3.0e-11
malignant mesothelioma 3163 2.1e-09
psoriasis 6685 4.9e-09
group 4 medulloblastoma 1875 2.0e-07
ovarian cancer 8491 4.8e-06
Pick disease 1893 3.7e-04
pituitary cancer 1972 1.3e-03
astrocytoma 1493 1.4e-03
oligodendroglioma 2849 2.8e-03
osteosarcoma 7933 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 156 0.0 1.0
Disease Target Count Z-score Confidence
Influenza 142 3.979 2.0

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -4.600 2.1e-09
oligodendroglioma 1.900 2.8e-03
psoriasis -1.300 4.9e-09
astrocytoma 2.100 1.4e-03
osteosarcoma -1.054 4.8e-02
group 4 medulloblastoma -2.700 2.0e-07
Breast cancer -2.600 3.0e-11
breast carcinoma -1.600 8.6e-20
Pick disease 1.500 3.7e-04
ovarian cancer 1.800 4.8e-06
pituitary cancer -2.000 1.3e-03

Pathway (1)

Gene RIF (4)

PMID Text
24161943 interaction between NAV2 and 14-3-3epsilon
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12214280 a novel gene, termed HELAD1 (helicase, APC down-regulated 1) plays important role in colorectal carcinogenesis (HELAD1)
11904404 regulated by all-trans retinoic acid in neuroblastoma cells

AA Sequence

MPAILVASKMKSGLPKPVHSAAPILHVPPARAGPQPCYLKLGSKVEVSKTTYPSQIPLKSQVLQGLQEPA      1 - 70
GEGLPLRKSGSVENGFDTQIYTDWANHYLAKSGHKRLIRDLQQDVTDGVLLAQIIQVVANEKIEDINGCP     71 - 140
KNRSQMIENIDACLNFLAAKGINIQGLSAEEIRNGNLKAILGLFFSLSRYKQQQQQPQKQHLSSPLPPAV    141 - 210
SQVAGAPSQCQAGTPQQQVPVTPQAPCQPHQPAPHQQSKAQAEMQSSASSKDSSQSKIIRFTLGQKKISR    211 - 280
LPGPTARVSAAGSEAKTRGGSTTANNRRSQSFNNYDKSKPVTSPPPPPSSHEKEPLASSASSHPGMSDNA    281 - 350
PASLESGSSSTPTNCSTSSAIPQPGAATKPWRSKSLSVKHSATVSMLSVKPPGPEAPRPTPEAMKPAPNN    351 - 420
QKSMLEKLKLFNSKGGSKAGEGPGSRDTSCERLETLPSFEESEELEAASRMLTTVGPASSSPKIALKGIA    421 - 490
QRTFSRALTNKKSSLKGNEKEKEKQQREKDKEKSKDLAKRASVTERLDLKEEPKEDPSGAAVPEMPKKSS    491 - 560
KIASFIPKGGKLNSAKKEPMAPSHSGIPKPGMKSMPGKSPSAPAPSKEGERSRSGKLSSGLPQQKPQLDG    561 - 630
RHSSSSSSLASSEGKGPGGTTLNHSISSQTVSGSVGTTQTTGSNTVSVQLPQPQQQYNHPNTATVAPFLY    631 - 700
RSQTDTEGNVTAESSSTGVSVEPSHFTKTGQPALEELTGEDPEARRLRTVKNIADLRQNLEETMSSLRGT    701 - 770
QVTHSTLETTFDTNVTTEMSGRSILSLTGRPTPLSWRLGQSSPRLQAGDAPSMGNGYPPRANASRFINTE    771 - 840
SGRYVYSAPLRRQLASRGSSVCHVDVSDKAGDEMDLEGISMDAPGYMSDGDVLSKNIRTDDITSGYMTDG    841 - 910
GLGLYTRRLNRLPDGMAVVRETLQRNTSLGLGDADSWDDSSSVSSGISDTIDNLSTDDINTSSSISSYAN    911 - 980
TPASSRKNLDVQTDAEKHSQVERNSLWSGDDVKKSDGGSDSGIKMEPGSKWRRNPSDVSDESDKSTSGKK    981 - 1050
NPVISQTGSWRRGMTAQVGITMPRTKPSAPAGALKTPGTGKTDDAKVSEKGRLSPKASQVKRSPSDAGRS   1051 - 1120
SGDESKKPLPSSSRTPTANANSFGFKKQSGSAAGLAMITASGVTVTSRSATLGKIPKSSALVSRSAGRKS   1121 - 1190
SMDGAQNQDDGYLALSSRTNLQYRSLPRPSKSNSRNGAGNRSSTSSIDSNISSKSAGLPVPKLREPSKTA   1191 - 1260
LGSSLPGLVNQTDKEKGISSDNESVASCNSVKVNPAAQPVSSPAQTSLQPGAKYPDVASPTLRRLFGGKP   1261 - 1330
TKQVPIATAENMKNSVVISNPHATMTQQGNLDSPSGSGVLSSGSSSPLYSKNVDLNQSPLASSPSSAHSA   1331 - 1400
PSNSLTWGTNASSSSAVSKDGLGFQSVSSLHTSCESIDISLSSGGVPSHNSSTGLIASSKDDSLTPFVRT   1401 - 1470
NSVKTTLSESPLSSPAASPKFCRSTLPRKQDSDPHLDRNTLPKKGLRYTPTSQLRTQEDAKEWLRSHSAG   1471 - 1540
GLQDTAANSPFSSGSSVTSPSGTRFNFSQLASPTTVTQMSLSNPTMLRTHSLSNADGQYDPYTDSRFRNS   1541 - 1610
SMSLDEKSRTMSRSGSFRDGFEEESWEKSSVDNFVSRLHSSLHFSLPLFHHARYELVHGSSLSLVSSTSS   1611 - 1680
VYSTPEEKCQSEIRKLRRELDASQEKVSALTTQLTANAHLVAAFEQSLGNMTIRLQSLTMTAEQKDSELN   1681 - 1750
ELRKTIELLKKQNAAAQAAINGVINTPELNCKGNGTAQSADLRIRRQHSSDSVSSINSATSHSSVGSNIE   1751 - 1820
SDSKKKKRKNWVNELRSSFKQAFGKKKSPKSASSHSDIEEMTDSSLPSSPKLPHNGSTGSTPLLRNSHSN   1821 - 1890
SLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSES   1891 - 1960
QGSGCSRAPSQVSISASPRQSMGLSQHSLNLTESTSLDMLLDDTGECSARKEGGRHVKIVVSFQEEMKWK   1961 - 2030
EDSRPHLFLIGCIGVSGKTKWDVLDGVVRRLFKEYIIHVDPVSQLGLNSDSVLGYSIGEIKRSNTSETPE   2031 - 2100
LLPCGYLVGENTTISVTVKGLAENSLDSLVFESLIPKPILQRYVSLLIEHRRIILSGPSGTGKTYLANRL   2101 - 2170
SEYIVLREGRELTDGVIATFNVDHKSSKELRQYLSNLADQCNSENNAVDMPLVIILDNLHHVSSLGEIFN   2171 - 2240
GLLNCKYHKCPYIIGTMNQATSSTPNLQLHHNFRWVLCANHTEPVKGFLGRFLRRKLMETEISGRVRNME   2241 - 2310
LVKIIDWIPKVWHHLNRFLEAHSSSDVTIGPRLFLSCPIDVDGSRVWFTDLWNYSIIPYLLEAVREGLQL   2311 - 2380
YGRRAPWEDPAKWVMDTYPWAASPQQHEWPPLLQLRPEDVGFDGYSMPREGSTSKQMPPSDAEGDPLMNM   2381 - 2450
LMRLQEAANYSSPQSYDSDSNSNSHHDDILDSSLESTL                                   2451 - 2488
//

Text Mined References (28)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24161943 2013 14-3-3? and NAV2 interact to regulate neurite outgrowth and axon elongation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22174851 2011 Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18937294 2008 Genome-wide association scan of the time to onset of attention deficit hyperactivity disorder.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15158073 2004 Sensory deficits in mice hypomorphic for a mammalian homologue of unc-53.
15031288 2004 Identification and characterization of rain, a novel Ras-interacting protein with a unique subcellular localization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12214280 2002 Isolation of HELAD1, a novel human helicase gene up-regulated in colorectal carcinomas.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12079279 2002 Neuron navigator: a human gene family with homology to unc-53, a cell guidance gene from Caenorhabditis elegans.
12062803 2002 Pore membrane and/or filament interacting like protein 1 (POMFIL1) is predominantly expressed in the nervous system and encodes different protein isoforms.
11904404 2002 A mammalian homolog of unc-53 is regulated by all-trans retinoic acid in neuroblastoma cells and embryos.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.