Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1070.89
PubTator Score 4.60

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

AA Sequence

MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVL      1 - 70
DAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTK     71 - 140
FEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC       141 - 207
//

Text Mined References (19)

PMID Year Title