Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1028.12
PubTator Score 4.60

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BTE0 B2R7F0 Q9BTD0 Q9Y3T3
Symbols EBSP, hNATL

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
20031577 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19139211 no evidence was found for association of SNPs mapping to the NAT9, SLC9A3R1 and RAPTOR loci with susceptibility to psoriatic arthritis
16944568 Results suggest that hNATL may play an important role in the development of embryo brain and may also be important for function of adult brain and gonad

AA Sequence

MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVL      1 - 70
DAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTK     71 - 140
FEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC       141 - 207
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21688147 2012 Characterization, expression profile, polymorphism and association of porcine NAT9 gene.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20031577 2009 Novel loci, including those related to Crohn disease, psoriasis, and inflammation, identified in a genome-wide association study of fibrinogen in 17 686 women: the Women's Genome Health Study.
19139211 2009 Investigation of association of genes NAT9, SLC9A3R1 and RAPTOR on chromosome 17q25 with psoriatic arthritis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16944568 2006 [Cloning and expression analysis of human N-acetyltransferase doman containing gene hNATL].
16381901 2006 The LIFEdb database in 2006.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14608357 2003 A putative RUNX1 binding site variant between SLC9A3R1 and NAT9 is associated with susceptibility to psoriasis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.