Property Summary

NCBI Gene PubMed Count 22
PubMed Score 49.55
PubTator Score 33.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Chronic Kidney Diseases 22
Disease Target Count P-value
psoriasis 6685 1.0e-04
nephrosclerosis 329 4.1e-02
Disease Target Count Z-score Confidence
Kidney disease 397 0.0 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
nephrosclerosis -1.685 4.1e-02
psoriasis -1.400 1.0e-04

Gene RIF (8)

PMID Text
26819345 Findings indicate that the NAA pathway has a prominent role in promoting tumor growth and represents a valuable target for anticancer therapy.
25301944 ATase1 and ATase2 are endoplasmic reticulum-based acetyltransferases that form homo- and heterodimers and associate with members of the oligosaccharyltransferase complex
22267734 Biochemical inhibition of the acetyltransferases ATase1 and ATase2 reduces beta-secretase (BACE1) levels and Abeta generation.
20392701 NAT8 is the enzyme that acetylates cysteine S-conjugates to mercapturic acids
20385109 NAT8L is the NAA biosynthetic enzyme Asp-N-acetyltransferase and is highly specific for the acetylation of aspartate.
20383145 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18402670 we raise the hypothesis that the alternative SNP alleles of the NAT8 upstream region may have differential effect on gene expression
18402670 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSWLLALVFSISL      1 - 70
FPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLF     71 - 140
HLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCVWARLVAL    141 - 210
HTVHFIYHLPSSKVGSL                                                         211 - 227
//

Text Mined References (23)

PMID Year Title
26819345 2016 Role of Increased n-acetylaspartate Levels in Cancer.
25301944 2014 The endoplasmic reticulum-based acetyltransferases, ATase1 and ATase2, associate with the oligosaccharyltransferase to acetylate correctly folded polypeptides.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24556617 2014 Post-translational regulation of CD133 by ATase1/ATase2-mediated lysine acetylation.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23535967 2013 Using multiple measures for quantitative trait association analyses: application to estimated glomerular filtration rate.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22267734 2012 Biochemical inhibition of the acetyltransferases ATase1 and ATase2 reduces ?-secretase (BACE1) levels and A? generation.
21931564 2011 A genome-wide metabolic QTL analysis in Europeans implicates two loci shaped by recent positive selection.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
20392701 2010 Molecular identification of NAT8 as the enzyme that acetylates cysteine S-conjugates to mercapturic acids.
20385109 2010 Methamphetamine-induced neuronal protein NAT8L is the NAA biosynthetic enzyme: implications for specialized acetyl coenzyme A metabolism in the CNS.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20383145 2010 Genetic loci influencing kidney function and chronic kidney disease.
19011241 2009 Two endoplasmic reticulum (ER)/ER Golgi intermediate compartment-based lysine acetyltransferases post-translationally regulate BACE1 levels.
18402670 2008 N-acetyltransferase 8, a positional candidate for blood pressure and renal regulation: resequencing, association and in silico study.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11397015 2001 Overexpression of camello, a member of a novel protein family, reduces blastomere adhesion and inhibits gastrulation in Xenopus laevis.
9852678 1998 Isolation and mapping of a novel human kidney- and liver-specific gene homologous to the bacterial acetyltransferases.
1139715 1975 [Agenesis and aplasia of the kidney in children in the x-ray diagnostic picture].