Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.61
PubTator Score 4.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical carcinoma 1.113 1.9e-03
fibroadenoma 1.100 2.6e-03
invasive ductal carcinoma 1.400 1.6e-02
ovarian cancer 1.400 9.1e-05
pituitary cancer 1.400 2.0e-05

Gene RIF (1)

PMID Text
19807691 Results indicated that NAT8L, but not NAT14, catalysed the synthesis of NAA from L-aspartate and acetyl-CoA.

AA Sequence

MAPSHLSVREMREDEKPLVLEMLKAGVKDTENRVALHALTRPPALLLLAAASSGLRFVLASFALALLLPV      1 - 70
FLAVAAVKLGLRARWGSLPPPGGLGGPWVAVRGSGDVCGVLALAPGTNAGDGARVTRLSVSRWHRRRGVG     71 - 140
RRLLAFAEARARAWAGGMGEPRARLVVPVAVAAWGVGGMLEGCGYQAEGGWGCLGYTLVREFSKDL        141 - 206
//

Text Mined References (8)

PMID Year Title
19807691 2009 Molecular identification of aspartate N-acetyltransferase and its mutation in hypoacetylaspartia.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11779635 2001 Genomic structure and regulation of a novel human gene, Klp1.
10873651 2000 Cloning of a coproporphyrinogen oxidase promoter regulatory element binding protein.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.