Property Summary

Ligand Count 5
NCBI Gene PubMed Count 225
PubMed Score 236.66
PubTator Score 363.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.200 4.0e-03
Astrocytoma, Pilocytic 1.300 8.8e-05
Barrett's esophagus 1.500 3.7e-02
breast carcinoma 2.700 4.2e-04
ependymoma 1.400 4.3e-05
esophageal adenocarcinoma 1.400 4.4e-02
glioblastoma 1.500 3.3e-05
hepatocellular carcinoma 1.300 2.4e-04
intraductal papillary-mucinous adenoma (... 1.500 6.1e-03
intraductal papillary-mucinous carcinoma... 1.600 1.6e-02
intraductal papillary-mucinous neoplasm ... 2.300 7.5e-03
invasive ductal carcinoma 1.889 1.6e-03
malignant mesothelioma -2.500 1.4e-08
ovarian cancer -1.700 7.2e-04
psoriasis 1.100 2.0e-03

 IMPC Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (231)

AA Sequence

MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQ      1 - 70
VNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISG     71 - 140
KDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQ    141 - 210
TSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLV    211 - 280
PKHGDRFFTI                                                                281 - 290
//

Text Mined References (228)

PMID Year Title