Property Summary

NCBI Gene PubMed Count 42
PubMed Score 58.30
PubTator Score 43.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
gastric cancer 1.300 1.8e-02
pancreatic cancer 1.300 3.4e-02
interstitial lung disease 1.100 1.7e-02
Waldenstrons macroglobulinemia 1.462 1.3e-02
Multiple myeloma 1.083 2.3e-03
malignant mesothelioma 1.900 7.7e-08
astrocytic glioma 2.600 2.3e-02
ependymoma 1.700 3.5e-02
oligodendroglioma 2.300 1.7e-02
psoriasis -1.900 5.8e-05
glioblastoma -2.200 2.2e-03
osteosarcoma -2.168 1.7e-06
group 3 medulloblastoma 1.800 2.0e-05
atypical teratoid / rhabdoid tumor -2.200 1.7e-03
medulloblastoma, large-cell -3.100 1.4e-04
primitive neuroectodermal tumor 1.100 8.1e-04
juvenile dermatomyositis 1.193 1.7e-07
breast carcinoma 1.100 1.8e-02
adult high grade glioma -1.700 3.4e-02
pancreatic carcinoma 1.300 3.4e-02
Pick disease -1.500 3.9e-04
progressive supranuclear palsy -1.600 8.9e-03
Breast cancer 1.100 3.0e-06
ovarian cancer 2.400 6.6e-08

Gene RIF (16)

PMID Text
26673727 findings reveal a new mode of interaction between a TPR repeat domain of histone chaperone sNASP and an evolutionarily conserved peptide motif found in canonical H3 and in all histone H3 variants
25669170 Our research demonstrates that knockdown of tNASP effectively inhibits the proliferation and causes G1 phase arrest through ERK/MAPK signal pathway.
25615412 These results provide evidence that tNASP is ubiquitously produced in various types of human tissues and promotes in vitro nucleosome assembly with H3 variant specificity.
24951090 NASP family Proteins are highly conserved throughout the eukaryotes and posses four TPR motifs. It was likely present in the last common ancestor of eukaryotes possibly representing an important innovation regarding H3/H4 transport mechanism. Different TPR motifs in NASP have evolved at different rates with TPR1/4 evolving faster than TPR2/3.
23364796 HIV-1 Tat upregulates the expression of nuclear autoantigenic sperm protein (NASP) in Jurkat cells
22968912 Studies indicate that histone chalerones nucleoplasmin (NPM2/NPM3) preferentially associated with histones H2A-H2B in the egg and the nuclear autoantigenic sperm protein (NASP) families.
22944692 HIV-1 Tat upregulates the expression of nuclear autoantigenic sperm protein (NASP) in Jurkat cells
22195965 The insights into NASP function and the existence of a tunable reservoir in mammalian cells demonstrate that contingency is integrated into the histone supply chain to respond to unexpected changes in demand.
22194605 an increase of miR-29a, and hence decrease of Nasp, may contribute to inhibit cell proliferation during postnatal organ development.
21965532 sNASP interacts with linker and core histones through distinct structural domains.
21496299 tNASP is critical for the survival of prostate cancer cells; targeting tNASP expression can lead to a new approach for prostate cancer treatment.
20167597 A deletion analysis of sNASP revealed that the central region, amino acid residues 26-325, of sNASP is responsible for nucleosome assembly in vitro.
20164540 NASP and RCAS1 proteins were more frequently expressed in ovarian cancer tissues than with normal ovarian tissue and serous cystadenomas and MRE11 was less frequently expressed
19439102 NASP belongs to a network of genes and gene functions that are critical for cell survival
18782834 NASP forms distinct, high specificity complexes with histones H3 and H4.
16728391 NASP and the linker histones are key players in the assembly of chromatin after DNA replication

AA Sequence

MAMESTATAAVAAELVSADKIEDVPAPSTSADKVESLDVDSEAKKLLGLGQKHLVMGDIPAAVNAFQEAA      1 - 70
SLLGKKYGETANECGEAFFFYGKSLLELARMENGVLGNALEGVHVEEEEGEKTEDESLVENNDNIDEEAR     71 - 140
EELREQVYDAMGEKEEAKKTEDKSLAKPETDKEQDSEMEKGGREDMDISKSAEEPQEKVDLTLDWLTETS    141 - 210
EEAKGGAAPEGPNEAEVTSGKPEQEVPDAEEEKSVSGTDVQEECREKGGQEKQGEVIVSIEEKPKEVSEE    211 - 280
QPVVTLEKQGTAVEVEAESLDPTVKPVDVGGDEPEEKVVTSENEAGKAVLEQLVGQEVPPAEESPEVTTE    281 - 350
AAEASAVEAGSEVSEKPGQEAPVLPKDGAVNGPSVVGDQTPIEPQTSIERLTETKDGSGLEEKVRAKLVP    351 - 420
SQEETKLSVEESEAAGDGVDTKVAQGATEKSPEDKVQIAANEETQEREEQMKEGEETEGSEEDDKENDKT    421 - 490
EEMPNDSVLENKSLQENEEEEIGNLELAWDMLDLAKIIFKRQETKEAQLYAAQAHLKLGEVSVESENYVQ    491 - 560
AVEEFQSCLNLQEQYLEAHDRLLAETHYQLGLAYGYNSQYDEAVAQFSKSIEVIENRMAVLNEQVKEAEG    561 - 630
SSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLVESSTSGFTPGGGGSSVSMIASRKPT    631 - 700
DGASSSNCVTDISHLVRKKRKPEEESPRKDDAKKAKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR    701 - 770
AAVEGTVEAGATVESTAC                                                        771 - 788
//

Text Mined References (54)

PMID Year Title
26673727 2016 The histone chaperone sNASP binds a conserved peptide motif within the globular core of histone H3 through its TPR repeats.
25669170 2015 Downregulation of tNASP inhibits proliferation through regulating cell cycle-related proteins and inactive ERK/MAPK signal pathway in renal cell carcinoma cells.
25615412 2015 Human tNASP promotes in vitro nucleosome assembly with histone H3.3.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24951090 2014 Molecular evolution of NASP and conserved histone H3/H4 transport pathway.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22968912 2012 Vertebrate nucleoplasmin and NASP: egg histone storage proteins with multiple chaperone activities.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22195965 2011 A specific function for the histone chaperone NASP to fine-tune a reservoir of soluble H3-H4 in the histone supply chain.
22194605 2012 MicroRNA-29a inhibited epididymal epithelial cell proliferation by targeting nuclear autoantigenic sperm protein (NASP).
21965532 2012 The human histone chaperone sNASP interacts with linker and core histones through distinct mechanisms.
21496299 2011 Depletion of the histone chaperone tNASP inhibits proliferation and induces apoptosis in prostate cancer PC-3 cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20167597 2010 Nucleosome formation activity of human somatic nuclear autoantigenic sperm protein (sNASP).
20164540 2010 Analysis of the expression of human tumor antigens in ovarian cancer tissues.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19498464 2009 The HP1alpha-CAF1-SetDB1-containing complex provides H3K9me1 for Suv39-mediated K9me3 in pericentric heterochromatin.
19439102 2009 Analysis of gene expression profiles in HeLa cells in response to overexpression or siRNA-mediated depletion of NASP.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18782834 2008 Expanded binding specificity of the human histone chaperone NASP.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16728391 2006 Nuclear autoantigenic sperm protein (NASP), a linker histone chaperone that is required for cell proliferation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15247327 2004 Generation of longer 3' cDNA fragments from massively parallel signature sequencing tags.
14718166 2004 Histone H3.1 and H3.3 complexes mediate nucleosome assembly pathways dependent or independent of DNA synthesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12509435 2003 Overexpression of the Linker histone-binding protein tNASP affects progression through the cell cycle.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11674998 2001 Comparison of mouse and human NASP genes and expression in human transformed and tumor cell lines.
11133655 2001 Analysis of gene expression in mouse 2-cell embryos using fluorescein differential display: comparison of culture environments.
10931132 2000 Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.
10893414 2000 Characterization of the histone H1-binding protein, NASP, as a cell cycle-regulated somatic protein.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8724350 1996 Histone-binding domains in a human nuclear autoantigenic sperm protein.
8363049 1993 Ultrastructural localization of a nuclear autoantigenic sperm protein in spermatogenic cells and spermatozoa.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
3549279 1986 Molecular characterization of a karyophilic, histone-binding protein: cDNA cloning, amino acid sequence and expression of nuclear protein N1/N2 of Xenopus laevis.
2289011 1990 Characterization of a sperm-specific nuclear autoantigenic protein. II. Expression and localization in the testis.
2289010 1990 Characterization of a sperm-specific nuclear autoantigenic protein. I. Complete sequence and homology with the Xenopus protein, N1/N2.
1426632 1992 Sequence and localization of human NASP: conservation of a Xenopus histone-binding protein.