Property Summary

NCBI Gene PubMed Count 17
PubMed Score 18.21
PubTator Score 23.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma -1.010 1.7e-02
group 3 medulloblastoma 1.200 1.1e-02
interstitial cystitis -1.200 1.1e-04
intraductal papillary-mucinous neoplasm ... 2.300 1.7e-04
osteosarcoma -1.244 3.1e-04
tuberculosis 1.900 6.2e-06

Protein-protein Interaction (2)

Gene RIF (6)

AA Sequence

MAAEQDPEARAAARPLLTDLYQATMALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGLRDCVRFLRAF      1 - 70
RLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLC     71 - 140
LVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGLTASTYSYLGGFDSSSNVLAGQLRGVPVAGT    141 - 210
LAHSFVTSFSGSEVPPDPMLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFP    211 - 280
RAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESV    281 - 350
LIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGS    351 - 420
KAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSL    421 - 490
AESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP                          491 - 538
//

Text Mined References (25)

PMID Year Title