Property Summary

NCBI Gene PubMed Count 26
PubMed Score 45.17
PubTator Score 33.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.400 4.5e-03
Alzheimer's disease -1.200 3.0e-02
astrocytic glioma -1.300 1.5e-02
atypical teratoid / rhabdoid tumor -2.100 1.9e-05
ependymoma -1.100 3.4e-02
glioblastoma -1.500 3.8e-06
group 3 medulloblastoma -1.200 1.2e-02
intraductal papillary-mucinous adenoma (... 1.300 2.7e-04
intraductal papillary-mucinous carcinoma... 1.300 2.2e-04
medulloblastoma, large-cell -2.100 1.2e-04
ovarian cancer 2.600 1.6e-06
Pick disease -1.400 1.5e-04

Protein-protein Interaction (7)

Gene RIF (6)

AA Sequence

MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRA      1 - 70
LFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQT     71 - 140
ANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDY    141 - 210
VAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGI    211 - 280
KKKSPATPQAKPDGVTATAADEEEDEYSGGLC                                          281 - 312
//

Text Mined References (31)

PMID Year Title