Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.56
PubTator Score 20.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -3.200 2.0e-03
posterior fossa group A ependymoma -3.800 2.6e-21
oligodendroglioma -2.700 6.3e-19
glioblastoma -4.200 7.4e-08
osteosarcoma -1.802 1.6e-07
sonic hedgehog group medulloblastoma -2.700 6.0e-08
atypical teratoid / rhabdoid tumor -4.400 1.6e-13
medulloblastoma, large-cell -2.900 4.9e-06
primitive neuroectodermal tumor -2.400 8.6e-06
intraductal papillary-mucinous neoplasm ... 1.100 3.8e-02
Breast cancer 3.300 2.2e-02
pediatric high grade glioma -3.900 2.2e-10
pilocytic astrocytoma -3.900 5.3e-16
lung carcinoma 1.900 7.6e-31
Pick disease -1.900 1.2e-02
progressive supranuclear palsy 1.100 1.5e-02
ovarian cancer -1.500 4.1e-07
cystic fibrosis and chronic rhinosinusit... 1.013 6.0e-03

 OMIM Phenotype (1)

AA Sequence

MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEEACEMYTRAANMFKMAKNWSAAGNAFCQAAK      1 - 70
LHMQLQSKHDSATSFVDAGNAYKKADPQEAINCLNAAIDIYTDMGRFTIAAKHHITIAEIYETELVDIEK     71 - 140
AIAHYEQSADYYKGEESNSSANKCLLKVAAYAAQLEQYQKAIEIYEQVGANTMDNPLLKYSAKDYFFKAA    141 - 210
LCHFIVDELNAKLALEKYEEMFPAFTDSRECKLLKKLLEAHEEQNSEAYTEAVKEFDSISRLDQWLTTML    211 - 280
LRIKKSIQGDGEGDGDLK                                                        281 - 298
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21516116 2011 Next-generation sequencing to generate interactome datasets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
9817754 1998 Syntaxin 13 mediates cycling of plasma membrane proteins via tubulovesicular recycling endosomes.
9697855 1998 The AMPA receptor GluR2 C terminus can mediate a reversible, ATP-dependent interaction with NSF and alpha- and beta-SNAPs.
8455721 1993 SNAP family of NSF attachment proteins includes a brain-specific isoform.
1315316 1992 A multisubunit particle implicated in membrane fusion.