Property Summary

NCBI Gene PubMed Count 7
PubMed Score 11.83
PubTator Score 14.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia -1.300 1.8e-03
adult high grade glioma -2.500 8.0e-06
aldosterone-producing adenoma -1.397 2.9e-02
astrocytoma -1.200 2.0e-11
Atopic dermatitis -1.700 4.6e-04
atypical teratoid / rhabdoid tumor -3.500 5.3e-06
Breast cancer -2.100 1.6e-13
colon cancer -1.900 6.3e-05
ependymoma -2.000 2.4e-10
glioblastoma -1.800 5.8e-05
group 3 medulloblastoma -1.400 1.1e-02
intraductal papillary-mucinous adenoma (... -2.100 2.2e-03
intraductal papillary-mucinous carcinoma... -2.300 2.0e-03
intraductal papillary-mucinous neoplasm ... -2.100 2.8e-02
lung carcinoma 2.700 1.1e-24
malignant mesothelioma -1.500 7.9e-05
medulloblastoma, large-cell -2.900 2.2e-05
oligodendroglioma -1.100 1.3e-07
ovarian cancer -4.700 2.1e-11
primitive neuroectodermal tumor -1.400 2.0e-02
psoriasis -1.600 1.4e-07
subependymal giant cell astrocytoma -1.405 2.3e-02
X-linked cerebral adrenoleukodystrophy -1.100 2.4e-02

AA Sequence

MAEADFKMVSEPVAHGVAEEEMASSTSDSGEESDSSSSSSSTSDSSSSSSTSGSSSGSGSSSSSSGSTSS      1 - 70
RSRLYRKKRVPEPSRRARRAPLGTNFVDRLPQAVRNRVQALRNIQDECDKVDTLFLKAIHDLERKYAELN     71 - 140
KPLYDRRFQIINAEYEPTEEECEWNSEDEEFSSDEEVQDNTPSEMPPLEGEEEENPKENPEVKAEEKEVP    141 - 210
KEIPEVKDEEKEVPKEIPEVKAEEKADSKDCMEATPEVKEDPKEVPQVKADDKEQPKATEAKARAAVRET    211 - 280
HKRVPEERLQDSVDLKRARKGKPKREDPKGIPDYWLIVLKNVDKLGPMIQKYDEPILKFLSDVSLKFSKP    281 - 350
GQPVSYTFEFHFLPNPYFRNEVLVKTYIIKAKPDHNDPFFSWGWEIEDCKGCKIDWRRGKDVTVTTTQSR    351 - 420
TTATGEIEIQPRVVPNASFFNFFSPPEIPMIGKLEPREDAILDEDFEIGQILHDNVILKSIYYYTGEVNG    421 - 490
TYYQFGKHYGNKKYRK                                                          491 - 506
//

Text Mined References (7)

PMID Year Title