Property Summary

NCBI Gene PubMed Count 9
PubMed Score 94.63
PubTator Score 7.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -3.400 7.9e-05
astrocytic glioma -2.600 2.4e-03
atypical teratoid / rhabdoid tumor -3.900 4.3e-07
Breast cancer -3.100 1.1e-21
colon cancer -3.100 5.7e-09
cutaneous lupus erythematosus -1.200 5.8e-03
ependymoma -2.600 4.1e-03
gastric cancer 1.200 1.7e-02
glioblastoma -3.300 1.2e-05
group 3 medulloblastoma -3.800 2.5e-04
intraductal papillary-mucinous adenoma (... -1.900 3.2e-03
intraductal papillary-mucinous carcinoma... -2.300 1.3e-03
intraductal papillary-mucinous neoplasm ... -2.300 1.2e-02
lung cancer -1.200 2.1e-02
lung carcinoma 2.400 6.3e-40
malignant mesothelioma 3.700 5.1e-09
medulloblastoma, large-cell -5.900 2.0e-08
oligodendroglioma -1.700 2.9e-02
ovarian cancer -2.900 4.5e-12
primitive neuroectodermal tumor -2.900 2.6e-03
psoriasis -1.900 2.1e-03
subependymal giant cell astrocytoma -2.629 7.8e-03

Synonym

Accession Q9ULW6 B2RE61 B4E161 Q8TAN6
Symbols BPX

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (2)

AA Sequence

MAESENRKELSESSQEEAGNQIMVEGLGEHLERGEDAAAGLGDDGKCGEEAAAGLGEEGENGEDTAAGSG      1 - 70
EDGKKGGDTDEDSEADRPKGLIGYVLDTDFVESLPVKVKYRVLALKKLQTRAANLESKFLREFHDIERKF     71 - 140
AEMYQPLLEKRRQIINAIYEPTEEECEYKSDSEDCDDEEMCHEEMYGNEEGMVHEYVDEDDGYEDYYYDY    141 - 210
AVEEEEEEEEEDDIEATGEENKEEEDPKGIPDFWLTVLKNVDTLTPLIKKYDEPILKLLTDIKVKLSDPG    211 - 280
EPLSFTLEFHFKPNEYFKNELLTKTYVLKSKLAYYDPHPYRGTAIEYSTGCEIDWNEGKNVTLKTIKKKQ    281 - 350
KHRIWGTIRTVTEDFPKDSFFNFFSPHGITSNGRDGNDDFLLGHNLRTYIIPRSVLFFSGDALESQQEGV    351 - 420
VREVNDAIYDKIIYDNWMAAIEEVKACCKNLEALVEDIDR                                  421 - 460
//

Text Mined References (11)

PMID Year Title