Property Summary

NCBI Gene PubMed Count 8
PubMed Score 86.91
PubTator Score 7.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
gastric cancer 1.200 1.7e-02
malignant mesothelioma 3.700 5.1e-09
astrocytic glioma -2.600 2.4e-03
ependymoma -2.600 4.1e-03
oligodendroglioma -2.100 7.3e-11
cutaneous lupus erythematosus -1.200 5.8e-03
psoriasis -1.900 2.1e-03
glioblastoma -5.000 4.1e-05
group 3 medulloblastoma -3.800 2.5e-04
atypical teratoid / rhabdoid tumor -3.900 4.3e-07
medulloblastoma, large-cell -5.900 2.0e-08
primitive neuroectodermal tumor -2.900 2.6e-03
intraductal papillary-mucinous adenoma (... -1.900 3.2e-03
intraductal papillary-mucinous carcinoma... -2.300 1.3e-03
intraductal papillary-mucinous neoplasm ... -2.300 1.2e-02
lung cancer -1.200 2.1e-02
colon cancer -3.100 5.7e-09
pediatric high grade glioma -4.200 1.0e-05
subependymal giant cell astrocytoma -2.629 7.8e-03
lung carcinoma 2.400 6.3e-40
Breast cancer -3.100 1.1e-21
ovarian cancer -2.900 4.5e-12

Synonym

Accession Q9ULW6 B2RE61 B4E161 Q8TAN6
Symbols BPX

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
21333655 Results identified several proteins interacting with NAP1L2, including the ubiquitously expressed members of the nucleosome assembly protein family, NAP1L1 and NAP1L4.

AA Sequence

MAESENRKELSESSQEEAGNQIMVEGLGEHLERGEDAAAGLGDDGKCGEEAAAGLGEEGENGEDTAAGSG      1 - 70
EDGKKGGDTDEDSEADRPKGLIGYVLDTDFVESLPVKVKYRVLALKKLQTRAANLESKFLREFHDIERKF     71 - 140
AEMYQPLLEKRRQIINAIYEPTEEECEYKSDSEDCDDEEMCHEEMYGNEEGMVHEYVDEDDGYEDYYYDY    141 - 210
AVEEEEEEEEEDDIEATGEENKEEEDPKGIPDFWLTVLKNVDTLTPLIKKYDEPILKLLTDIKVKLSDPG    211 - 280
EPLSFTLEFHFKPNEYFKNELLTKTYVLKSKLAYYDPHPYRGTAIEYSTGCEIDWNEGKNVTLKTIKKKQ    281 - 350
KHRIWGTIRTVTEDFPKDSFFNFFSPHGITSNGRDGNDDFLLGHNLRTYIIPRSVLFFSGDALESQQEGV    351 - 420
VREVNDAIYDKIIYDNWMAAIEEVKACCKNLEALVEDIDR                                  421 - 460
//

Text Mined References (10)

PMID Year Title
21333655 2011 Interaction between nucleosome assembly protein 1-like family members.
18985028 2008 Hepatitis C virus infection protein network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12116227 2002 SNPs in the CpG island of NAP1L2: a possible link between DNA methylation and neural tube defects?
10932189 2000 Control of neurulation by the nucleosome assembly protein-1-like 2.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8789438 1996 Cloning and characterization of a murine brain specific gene Bpx and its human homologue lying within the Xic candidate region.