Property Summary

NCBI Gene PubMed Count 8
PubMed Score 225.58
PubTator Score 8.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 6.2e-04
Disease Target Count Z-score Confidence
Malaria 140 6.599 3.3
Tetanus 66 3.322 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 6.2e-04

Synonym

Accession Q8TBE9 B3KP12 Q5JYN8 Q8TE97 Q9Y3N0
Symbols HDHD4
C20orf147
dJ694B14.3

Gene

PANTHER Protein Class (1)

PDB

2W4M   4KNV   4KNW  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITD      1 - 70
LRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQRE     71 - 140
KIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWIN    141 - 210
KNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST                                    211 - 248
//

Text Mined References (8)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16237198 2006 Identification of the sequence encoding N-acetylneuraminate-9-phosphate phosphatase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.