Property Summary

Ligand Count 334
NCBI Gene PubMed Count 425
PubMed Score 1054.31
PubTator Score 881.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (33)

Disease log2 FC p
acute myeloid leukemia 2.400 4.0e-02
acute quadriplegic myopathy 1.400 5.7e-04
adrenocortical carcinoma -1.572 8.1e-03
adult high grade glioma 1.700 2.4e-03
astrocytic glioma 2.200 6.1e-03
axial spondyloarthropathy 1.100 4.7e-02
chronic lymphosyte leukemia -1.300 1.2e-03
ependymoma 2.400 3.9e-02
gastric cancer -1.100 1.1e-03
glioblastoma 1.200 4.2e-02
group 4 medulloblastoma -1.200 8.8e-03
head and neck cancer 1.600 1.3e-06
hepatocellular carcinoma -1.300 1.2e-05
interstitial cystitis 1.100 2.9e-02
interstitial lung disease -2.000 1.7e-02
intraductal papillary-mucinous adenoma (... -2.000 2.2e-02
lung cancer -4.500 7.7e-06
malignant mesothelioma -1.500 9.4e-07
medulloblastoma, large-cell -1.200 1.5e-04
non primary Sjogren syndrome sicca -1.100 1.3e-02
non-small cell lung cancer -2.409 1.6e-13
ovarian cancer -1.100 1.9e-02
pancreatic cancer 1.600 6.0e-03
pancreatic ductal adenocarcinoma liver m... -2.436 5.8e-03
permanent atrial fibrillation -1.200 3.3e-02
Pick disease 1.900 6.3e-03
pituitary cancer -3.300 6.0e-08
progressive supranuclear palsy -1.500 1.8e-02
psoriasis 1.500 6.9e-08
Rheumatoid arthritis 1.800 3.5e-02
tuberculosis -1.300 3.7e-02
ulcerative colitis 1.600 2.1e-07
urothelial carcinoma -2.100 6.8e-03

PDB (54)

Gene RIF (412)

AA Sequence

MNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYL      1 - 70
KGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPE     71 - 140
CYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASA    141 - 210
HLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDS    211 - 280
YDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRV    281 - 350
IQGDGVDINTLQEIVEGMKQKMWSIENIAFGSGGGLLQKLTRDLLNCSFKCSYVVTNGLGINVFKDPVAD    351 - 420
PNKRSKKGRLSLHRTPAGNFVTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAH    421 - 490
H//

Text Mined References (432)

PMID Year Title