Property Summary

NCBI Gene PubMed Count 23
PubMed Score 42.74
PubTator Score 22.14

Knowledge Summary

Patent (3,662)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Kidney cancer 121 0.0 1.0
Disease Target Count Z-score Confidence
Dementia 129 0.0 1.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 383 0.0 4.0

Expression

  Differential Expression (18)

Disease log2 FC p
glioblastoma -3.900 2.8e-04
osteosarcoma -1.759 2.3e-02
ependymoma -1.500 1.6e-04
group 3 medulloblastoma -3.400 8.8e-05
atypical teratoid / rhabdoid tumor -4.900 1.1e-08
medulloblastoma, large-cell -5.300 1.6e-07
primitive neuroectodermal tumor -2.500 1.7e-03
intraductal papillary-mucinous adenoma (... -1.400 2.3e-02
intraductal papillary-mucinous carcinoma... -2.200 1.6e-03
intraductal papillary-mucinous neoplasm ... -2.200 9.4e-03
interstitial cystitis -2.300 7.7e-05
pediatric high grade glioma -3.100 7.2e-05
subependymal giant cell astrocytoma -2.180 3.3e-02
lung carcinoma 2.800 4.1e-31
Pick disease -1.300 4.6e-03
Breast cancer -2.200 1.2e-20
ovarian cancer 2.400 4.3e-04
psoriasis -1.200 1.2e-33

Protein-protein Interaction (1)

Gene RIF (13)

PMID Text
26708753 UNC80 encodes a large protein that is necessary for the stability and function of NALCN and for bridging NALCN to UNC79 to form a functional complex
26134120 Ohmic leak currents were identified in freshly isolated and cultured myometrial smooth muscle cells. NALCN contributes to this current. Uterine biopsies from term, non-laboring women revealed NALCN messenger RNA and protein expression in the myometrium.
25683120 We used exome and targeted next-generation sequencing to identify de novo mutations in NALCN as the cause of a newly delineated condition, CLIFAHDD syndrome.
24227479 This study found a plausible association, though not statistically confirmed, of cervical dystonia with SNPs in the NALCN region.
24075186 Two mutations, one missense and one nonsense, in NALCN in two unrelated families.
23749988 NALCN is the gene responsible for INAD with facial dysmorphism
20889312 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20674038 This study observed nominal association with rs9518320 and rs9518331, suggesting that NALCN is not related to schizophrenia risk.
20674038 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19575010 Data show the molecular basis of a muscarinic-activated inward sodium current that is independent of G-protein activation, and provide new insights into the properties of NALCN channels.
19535918 UNC80 functions as a scaffold for Src kinases in NALCN channel function.
19308021 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLKRKQSSRVEAQPVTDFGPDESLSDNADILWINKPWVHSLLRICAIISVISVCMNTPMTFEHYPPLQYV      1 - 70
TFTLDTLLMFLYTAEMIAKMHIRGIVKGDSSYVKDRWCVFDGFMVFCLWVSLVLQVFEIADIVDQMSPWG     71 - 140
MLRIPRPLIMIRAFRIYFRFELPRTRITNILKRSGEQIWSVSIFLLFFLLLYGILGVQMFGTFTYHCVVN    141 - 210
DTKPGNVTWNSLAIPDTHCSPELEEGYQCPPGFKCMDLEDLGLSRQELGYSGFNEIGTSIFTVYEAASQE    211 - 280
GWVFLMYRAIDSFPRWRSYFYFITLIFFLAWLVKNVFIAVIIETFAEIRVQFQQMWGSRSSTTSTATTQM    281 - 350
FHEDAAGGWQLVAVDVNKPQGRAPACLQKMMRSSVFHMFILSMVTVDVIVAASNYYKGENFRRQYDEFYL    351 - 420
AEVAFTVLFDLEALLKIWCLGFTGYISSSLHKFELLLVIGTTLHVYPDLYHSQFTYFQVLRVVRLIKISP    421 - 490
ALEDFVYKIFGPGKKLGSLVVFTASLLIVMSAISLQMFCFVEELDRFTTFPRAFMSMFQILTQEGWVDVM    491 - 560
DQTLNAVGHMWAPVVAIYFILYHLFATLILLSLFVAVILDNLELDEDLKKLKQLKQSEANADTKEKLPLR    561 - 630
LRIFEKFPNRPQMVKISKLPSDFTVPKIRESFMKQFIDRQQQDTCCLLRSLPTTSSSSCDHSKRSAIEDN    631 - 700
KYIDQKLRKSVFSIRARNLLEKETAVTKILRACTRQRMLSGSFEGQPAKERSILSVQHHIRQERRSLRHG    701 - 770
SNSQRISRGKSLETLTQDHSNTVRYRNAQREDSEIKMIQEKKEQAEMKRKVQEEELRENHPYFDKPLFIV    771 - 840
GREHRFRNFCRVVVRARFNASKTDPVTGAVKNTKYHQLYDLLGLVTYLDWVMIIVTICSCISMMFESPFR    841 - 910
RVMHAPTLQIAEYVFVIFMSIELNLKIMADGLFFTPTAVIRDFGGVMDIFIYLVSLIFLCWMPQNVPAES    911 - 980
GAQLLMVLRCLRPLRIFKLVPQMRKVVRELFSGFKEIFLVSILLLTLMLVFASFGVQLFAGKLAKCNDPN    981 - 1050
IIRREDCNGIFRINVSVSKNLNLKLRPGEKKPGFWVPRVWANPRNFNFDNVGNAMLALFEVLSLKGWVEV   1051 - 1120
RDVIIHRVGPIHGIYIHVFVFLGCMIGLTLFVGVVIANFNENKGTALLTVDQRRWEDLKSRLKIAQPLHL   1121 - 1190
PPRPDNDGFRAKMYDITQHPFFKRTIALLVLAQSVLLSVKWDVEDPVTVPLATMSVVFTFIFVLEVTMKI   1191 - 1260
IAMSPAGFWQSRRNRYDLLVTSLGVVWVVLHFALLNAYTYMMGACVIVFRFFSICGKHVTLKMLLLTVVV   1261 - 1330
SMYKSFFIIVGMFLLLLCYAFAGVVLFGTVKYGENINRHANFSSAGKAITVLFRIVTGEDWNKIMHDCMV   1331 - 1400
QPPFCTPDEFTYWATDCGNYAGALMYFCSFYVIIAYIMLNLLVAIIVENFSLFYSTEEDQLLSYNDLRHF   1401 - 1470
QIIWNMVDDKREGVIPTFRVKFLLRLLRGRLEVDLDKDKLLFKHMCYEMERLHNGGDVTFHDVLSMLSYR   1471 - 1540
SVDIRKSLQLEELLAREQLEYTIEEEVAKQTIRMWLKKCLKRIRAKQQQSCSIIHSLRESQQQELSRFLN   1541 - 1610
PPSIETTQPSEDTNANSQDNSMQPETSSQQQLLSPTLSDRGGSRQDAADAGKPQRKFGQWRLPSAPKPIS   1611 - 1680
HSVSSVNLRFGGRTTMKSVVCKMNPMTDAASCGSEVKKWWTRQLTVESDESGDDLLDI               1681 - 1738
//

Text Mined References (28)

PMID Year Title
27214504 2016 Novel Mutations in the Nonselective Sodium Leak Channel (NALCN) Lead to Distal Arthrogryposis with Increased Muscle Tone.
26763878 2016 De novo missense mutations in NALCN cause developmental and intellectual impairment with hypotonia.
26708753 2016 Mutations in UNC80, Encoding Part of the UNC79-UNC80-NALCN Channel Complex, Cause Autosomal-Recessive Severe Infantile Encephalopathy.
26134120 2015 Sodium leak channel, non-selective contributes to the leak current in human myometrial smooth muscle cells from pregnant women.
25864427 2015 A Gain-of-Function Mutation in NALCN in a Child with Intellectual Disability, Ataxia, and Arthrogryposis.
25683120 2015 De novo mutations in NALCN cause a syndrome characterized by congenital contractures of the limbs and face, hypotonia, and developmental delay.
25416956 2014 A proteome-scale map of the human interactome network.
24227479 2014 Genomewide association study in cervical dystonia demonstrates possible association with sodium leak channel.
24132900 2013 Genome-wide association study of atypical psychosis.
24075186 2013 Mutations in NALCN cause an autosomal-recessive syndrome with severe hypotonia, speech impairment, and cognitive delay.
23749988 2013 Recessive truncating NALCN mutation in infantile neuroaxonal dystrophy with facial dysmorphism.
23144319 2013 Prognostic implications of genetic variants in advanced non-small cell lung cancer: a genome-wide association study.
22628157 2012 Genome-wide association study of neurocognitive impairment and dementia in HIV-infected adults.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20674038 2011 Lack of association of NALCN genetic variants with schizophrenia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19575010 2009 The NALCN ion channel is activated by M3 muscarinic receptors in a pancreatic beta-cell line.
19535918 UNC80 functions as a scaffold for Src kinases in NALCN channel function.
19308021 2009 Findings from bipolar disorder genome-wide association studies replicate in a Finnish bipolar family-cohort.
17448995 2007 The neuronal channel NALCN contributes resting sodium permeability and is required for normal respiratory rhythm.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12498692 2002 An unusual cation channel mediates photic control of locomotion in Drosophila.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12364586 2002 Genetic and physiological data implicating the new human gene G72 and the gene for D-amino acid oxidase in schizophrenia.
11991713 2002 An evaluation of the assembly of an approximately 15-Mb region on human chromosome 13q32-q33 linked to bipolar disorder and schizophrenia.