Property Summary

NCBI Gene PubMed Count 49
PubMed Score 183.89
PubTator Score 143.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
pancreatic cancer 1.500 1.1e-03
malignant mesothelioma 2.200 3.2e-07
astrocytic glioma 1.400 4.5e-02
oligodendroglioma 1.100 2.1e-03
group 3 medulloblastoma 1.400 3.3e-02
medulloblastoma, large-cell -1.200 2.4e-02
tuberculosis 1.700 1.3e-04
pancreatic carcinoma 1.500 1.1e-03
subependymal giant cell astrocytoma 1.188 2.4e-02
ovarian cancer -1.600 4.2e-08

Gene RIF (40)

PMID Text
26347229 NAIP and survivin expressions were significantly reduced following varicocele induction when compared to sham animals whereas PDRN-treated rats showed an increase in NAIP and survivin levels.
26109648 human Naip functions to activate the inflammasome in response to flagellin, similar to murine Naip5/6.
25888055 The copy numbers and gene structures of NAIP genes were different in Chinese spinal muscular atrophy patients and healthy controls
25330799 results revealed that SMN2 and NAIP copy numbers significantly influenced the age at onset, risk of death, and life expectancy in the spinal muscular atrophy patients and that the effect of SMN2 was more significant
25137037 Modulation of chemotherapeutic drug resistance in neuroblastoma SK-N-AS cells by the neural apoptosis inhibitory protein and miR-520f.
24711022 Copy number variations of SMN2 and NAIP genes in patients are related to spinal muscular atrophy clinical types (P < 0.05).
23994529 identified an intronic region of the NAIP gene responding to TEAD1/YAP activity, suggesting that regulation of NAIP by TEAD1/YAP is at the transcriptional level
23940371 /NAIP1 and NAIP2/5 formed a large oligomeric complex with NLRC4 in the presence of corresponding bacterial ligands, and could support reconstitution of the NLRC4 inflammasome in a ligand-specific manner.
23012363 the NAIP5-NLRC4 inflammasome is induced by direct interactions with conserved N- and C-terminal regions of flagellin
22067212 NAIPFull gene duplication might have been evolutionary maintained, or even selected for, because it may confer an advantage to the host against flagellated bacteria
21821450 There is a close relationship between SMN2, NAIP and H4F5 gene copy number and spinal muscular atrophy disease severity
21371431 NOD domain is essential for effective inhibition of procaspase-9 and procaspase-3 cleavage by the NAIP protein in apoptosis.
20171302 an inhibitor of procaspase-9 preventing apoptosis at the initiation stage
20044205 Expression of NAIP may be associated with enhanced survival of prostate cancer in response to castration
19923725 Results provide the first structures of BIR domains from human NAIP and cIAP2.
19488400 a novel NAIP isoform derives from intragenic Alu SINE promoters
19287802 higher number of SMN2 copies makes the clinical symptoms more benign, and the NAIP gene deletion is associated with a more severe phenotype
19287802 Observational study of gene-disease association. (HuGE Navigator)
19198020 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19198020 findings of homozygous deletions of exon 7 and/or exon 8 of SMN1 gene confirmed the diagnosis of SMA, and suggested that the deletion of SMN1 exon 7 is a major cause of SMA in southern Chinese children.
18974562 Among the SMA Type I patients, 43% showed deletions of SMN1 and NAIP.
18842367 Data show that NAIP deletion predicts disease severity in spinal muscular atrophy.
18842367 Observational study of gene-disease association. (HuGE Navigator)
18759060 in glioma & glioblastoma multiforme, selective upregulation of miRNA-221 & down-regulation of a miRNA-221 mRNA target encoding BIRC1 were observed; expression of BIRC5 & caspase-3 were found to be significantly up-regulated, particularly in stage IV GBM
18566024 HIAP-1 and HIAP-2 mRNA levels were elevated in resting T cells while NAIP mRNA was increased in whole blood in multiple sclerosis
18533950 The presence of one NAIP copy, that is, heterozygous NAIP deletion, was common in Vietnamese SMA, regardless of clinical phenotype.
18453601 hNAIP and hIpaf mediate innate intracellular defense against flagellated Legionella in human cells.
18339188 Data show elevated expression of NAIP in peripheral mononuclear cells from children with Fabry disease.
18071605 The present study is the first one giving detailed information on SMN and NAIP deletion rates in Iranian SMA patients.
18071605 Observational study of genotype prevalence. (HuGE Navigator)
17932457 May be a modifying factor for disease severity of spinal muscular atrophy.
17923748 While there was no evidence of NAIP expression in the normal breast tissue, NAIP was expressed in all breast cancer samples.
17903057 80% neuronal apoptosis inhibitory protein gene deletion in 5q-spinal muscular atrophy patients (91% spinal muscular atrophy-I, 50% spinal muscular atrophy-II and -III), and in 5% (two of forty) of spinal muscular atrophy parents, was found.
17510375 a role for NAIP in increasing the survival of cells undergoing terminal differentiation as well as the possibility that the protein serves as an intestinal pathogen recognition protein was suggested
17222062 Multiple, domesticated long terminal repeats (LTRs) of endogenous retroviral elements provide NAIP promoter function in human, mouse, and rat.
15340105 Alterations in C/CAAT enhancer binding protein alpha and neuronal apoptosis inhibitory protein expression occurred in human adipose stromal-vascular cells after weight loss
15280366 NAIP does not interact with Smac and requires ATP to bind caspase-9
12445469 NAIP:Structural requirements for binding hippocalcin and effects on survival of sympathetic neurons.
12127562 NAIP-deltaEx10-11: a novel splice variant of the apoptosis inhibitor NAIP is differently expressed in drug-sensitive and multidrug-resistant HL60 leukemia cells. NAIP transcripts might be involved in tumor resistance to chemotherapeutic agents.
11912351 NAIP gene deletion was higher in type I spinal muscular atrophy than in type U or V. In type I patients lacking the NAIP gene, deterioration in their respiratory function is more rapid than in those type I patients retaining the NAIP gene.

AA Sequence

MATQQKASDERISQFDHNLLPELSALLGLDAVQLAKELEEEEQKERAKMQKGYNSQMRSEAKRLKTFVTY      1 - 70
EPYSSWIPQEMAAAGFYFTGVKSGIQCFCCSLILFGAGLTRLPIEDHKRFHPDCGFLLNKDVGNIAKYDI     71 - 140
RVKNLKSRLRGGKMRYQEEEARLASFRNWPFYVQGISPCVLSEAGFVFTGKQDTVQCFSCGGCLGNWEEG    141 - 210
DDPWKEHAKWFPKCEFLRSKKSSEEITQYIQSYKGFVDITGEHFVNSWVQRELPMASAYCNDSIFAYEEL    211 - 280
RLDSFKDWPRESAVGVAALAKAGLFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTRCFPNCPFLQNMKS    281 - 350
SAEVTPDLQSRGELCELLETTSESNLEDSIAVGPIVPEMAQGEAQWFQEAKNLNEQLRAAYTSASFRHMS    351 - 420
LLDISSDLATDHLLGCDLSIASKHISKPVQEPLVLPEVFGNLNSVMCVEGEAGSGKTVLLKKIAFLWASG    421 - 490
CCPLLNRFQLVFYLSLSSTRPDEGLASIICDQLLEKEGSVTEMCVRNIIQQLKNQVLFLLDDYKEICSIP    491 - 560
QVIGKLIQKNHLSRTCLLIAVRTNRARDIRRYLETILEIKAFPFYNTVCILRKLFSHNMTRLRKFMVYFG    561 - 630
KNQSLQKIQKTPLFVAAICAHWFQYPFDPSFDDVAVFKSYMERLSLRNKATAEILKATVSSCGELALKGF    631 - 700
FSCCFEFNDDDLAEAGVDEDEDLTMCLMSKFTAQRLRPFYRFLSPAFQEFLAGMRLIELLDSDRQEHQDL    701 - 770
GLYHLKQINSPMMTVSAYNNFLNYVSSLPSTKAGPKIVSHLLHLVDNKESLENISENDDYLKHQPEISLQ    771 - 840
MQLLRGLWQICPQAYFSMVSEHLLVLALKTAYQSNTVAACSPFVLQFLQGRTLTLGALNLQYFFDHPESL    841 - 910
SLLRSIHFPIRGNKTSPRAHFSVLETCFDKSQVPTIDQDYASAFEPMNEWERNLAEKEDNVKSYMDMQRR    911 - 980
ASPDLSTGYWKLSPKQYKIPCLEVDVNDIDVVGQDMLEILMTVFSASQRIELHLNHSRGFIESIRPALEL    981 - 1050
SKASVTKCSISKLELSAAEQELLLTLPSLESLEVSGTIQSQDQIFPNLDKFLCLKELSVDLEGNINVFSV   1051 - 1120
IPEEFPNFHHMEKLLIQISAEYDPSKLVKLIQNSPNLHVFHLKCNFFSDFGSLMTMLVSCKKLTEIKFSD   1121 - 1190
SFFQAVPFVASLPNFISLKILNLEGQQFPDEETSEKFAYILGSLSNLEELILPTGDGIYRVAKLIIQQCQ   1191 - 1260
QLHCLRVLSFFKTLNDDSVVEIAKVAISGGFQKLENLKLSINHKITEEGYRNFFQALDNMPNLQELDISR   1261 - 1330
HFTECIKAQATTVKSLSQCVLRLPRLIRLNMLSWLLDADDIALLNVMKERHPQSKYLTILQKWILPFSPI   1331 - 1400
IQK                                                                      1401 - 1403
//

Text Mined References (52)

PMID Year Title
26347229 2015 Role of Inhibitors of Apoptosis Proteins in Testicular Function and Male Fertility: Effects of Polydeoxyribonucleotide Administration in Experimental Varicocele.
26109648 2015 Cutting Edge: Inflammasome Activation in Primary Human Macrophages Is Dependent on Flagellin.
25888055 2015 Molecular characterization and copy number of SMN1, SMN2 and NAIP in Chinese patients with spinal muscular atrophy and unrelated healthy controls.
25330799 2015 Association of copy numbers of survival motor neuron gene 2 and neuronal apoptosis inhibitory protein gene with the natural history in a Chinese spinal muscular atrophy cohort.
25137037 2015 Modulation of chemotherapeutic drug resistance in neuroblastoma SK-N-AS cells by the neural apoptosis inhibitory protein and miR-520f.
24711022 2014 [Analysis and carrier screening for copy numbers of SMN and NAIP genes in children with spinal muscular atrophy].
23994529 2013 Interaction with the Yes-associated protein (YAP) allows TEAD1 to positively regulate NAIP expression.
23940371 2013 Human NAIP and mouse NAIP1 recognize bacterial type III secretion needle protein for inflammasome activation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23012363 2012 Formation and structure of a NAIP5-NLRC4 inflammasome induced by direct interactions with conserved N- and C-terminal regions of flagellin.
22504023 2012 The human apoptosis inhibitor NAIP induces pyroptosis in macrophages infected with Legionella pneumophila.
22067212 2012 Population variation in NAIP functional copy number confers increased cell death upon Legionella pneumophila infection.
21918512 2011 The NLRC4 inflammasome receptors for bacterial flagellin and type III secretion apparatus.
21821450 2012 Correlation of SMN2, NAIP, p44, H4F5 and Occludin genes copy number with spinal muscular atrophy phenotype in Tunisian patients.
21371431 2011 Integrity of ATP binding site is essential for effective inhibition of the intrinsic apoptosis pathway by NAIP.
20171302 2010 Neuronal apoptosis inhibitory protein, NAIP, is an inhibitor of procaspase-9.
20044205 2010 Induction of neuronal apoptosis inhibitory protein expression in response to androgen deprivation in prostate cancer.
19923725 2009 Structures of BIR domains from human NAIP and cIAP2.
19488400 2009 A novel protein isoform of the multicopy human NAIP gene derives from intragenic Alu SINE promoters.
19287802 2009 Phenotype modifiers of spinal muscular atrophy: the number of SMN2 gene copies, deletion in the NAIP gene and probably gender influence the course of the disease.
19198020 2009 Deletion analysis of SMN1 and NAIP genes in Southern Chinese children with spinal muscular atrophy.
18974562 Deletion analysis of spinal muscular atrophy in southern Indian population.
18842367 2009 Combination of SMN2 copy number and NAIP deletion predicts disease severity in spinal muscular atrophy.
18759060 2009 Up-regulation of micro-RNA-221 (miRNA-221; chr Xp11.3) and caspase-3 accompanies down-regulation of the survivin-1 homolog BIRC1 (NAIP) in glioblastoma multiforme (GBM).
18566024 2008 Expression of the inhibitor of apoptosis protein family in multiple sclerosis reveals a potential immunomodulatory role during autoimmune mediated demyelination.
18533950 2008 SMN2 and NAIP gene dosages in Vietnamese patients with spinal muscular atrophy.
18453601 2008 NAIP and Ipaf control Legionella pneumophila replication in human cells.
18414036 2008 IAPs: more than just inhibitors of apoptosis proteins.
18339188 2008 Apoptotic abnormalities in differential gene expression in peripheral blood mononuclear cells from children with Fabry disease.
18071605 2007 Molecular analysis of the SMN1 and NAIP genes in Iranian patients with spinal muscular atrophy.
17932457 2007 NAIP-deletion analysis in Malaysian patients with spinal muscular atrophy.
17923748 2007 Neuronal apoptosis inhibitory protein is overexpressed in patients with unfavorable prognostic factors in breast cancer.
17903057 2007 Molecular analysis of the neuronal apoptosis inhibitory protein gene in families with spinal muscular atrophy.
17510375 2007 Distribution of neuronal apoptosis inhibitory protein in human tissues.
17222062 2007 Repeated recruitment of LTR retrotransposons as promoters by the anti-apoptotic locus NAIP during mammalian evolution.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15340105 2004 Adipogenic and antiapoptotic protein levels in human adipose stromal cells after weight loss.
15280366 2004 Neuronal apoptosis-inhibitory protein does not interact with Smac and requires ATP to bind caspase-9.
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445469 2002 Neuronal apoptosis inhibitory protein: Structural requirements for hippocalcin binding and effects on survival of NGF-dependent sympathetic neurons.
12127562 2002 NAIP-deltaEx10-11: a novel splice variant of the apoptosis inhibitor NAIP differently expressed in drug-sensitive and multidrug-resistant HL60 leukemia cells.
11955612 2002 Functional human NAIP promoter transcription regulatory elements for the NAIP and PsiNAIP genes.
11912351 2002 Molecular genetics of spinal muscular atrophy: contribution of the NAIP gene to clinical severity.
11896143 2002 The neuronal apoptosis inhibitory protein is a direct inhibitor of caspases 3 and 7.
10544044 1999 Identification of two distinct transcripts for the neuronal apoptosis inhibitory protein gene.
10369862 1999 A single nucleotide difference that alters splicing patterns distinguishes the SMA gene SMN1 from the copy gene SMN2.
9503025 1998 Sequence of a 131-kb region of 5q13.1 containing the spinal muscular atrophy candidate genes SMN and NAIP.
8552191 1996 Suppression of apoptosis in mammalian cells by NAIP and a related family of IAP genes.
7813013 1995 The gene for neuronal apoptosis inhibitory protein is partially deleted in individuals with spinal muscular atrophy.
7552146 1995 A provisional transcript map of the spinal muscular atrophy (SMA) critical region.